KEGG   Lysinimonas sp. 2DFWR-13: D7I47_03855Help
Entry
D7I47_03855       CDS       T05661                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lyd  Lysinimonas sp. 2DFWR-13
Pathway
lyd00020  Citrate cycle (TCA cycle)
lyd00480  Glutathione metabolism
lyd01100  Metabolic pathways
lyd01110  Biosynthesis of secondary metabolites
lyd01120  Microbial metabolism in diverse environments
lyd01130  Biosynthesis of antibiotics
lyd01200  Carbon metabolism
lyd01210  2-Oxocarboxylic acid metabolism
lyd01230  Biosynthesis of amino acids
Module
lyd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lyd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lyd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D7I47_03855
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D7I47_03855
Enzymes [BR:lyd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     D7I47_03855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AYF97472
UniProt: A0A387B1U3
LinkDB All DBs
Position
complement(789361..790578)
Genome map
AA seq 405 aa AA seqDB search
MVEKIKVEGTVVELDGDEMTRIIWQFIKDRLIHPYLDVNLEYYDLGIENRDATDDQVTID
AAHAIQKHGVGVKCATITPDEARVAEFGLKKMWKSPNGTIRNILGGVIFREPIVISNIPR
LVPGWNKPIIIGRHAFGDQYRATDFVFDGPGTLTLSFQPADGGEAQSFEVFQAPDGGVAM
AMYNQDPSIRDFARASFNYGLSRGYPVYLSTKNTILKAYDGRFKDLFQEVFDAEYKERFE
AAGITYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLTTPDG
KVVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIFAWTRGLMHRGKLDGNQALIDFAETLE
DVVIKTVESGKMTKDLAILVGPEQEWQTTEDFLASLDENLAARLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgagaagatcaaggtcgaggggacggtcgtcgaactcgacggcgacgagatgacc
cgcatcatctggcagttcatcaaggaccgcctcatccacccctacctcgacgtgaacctc
gagtactacgacctcggcatcgagaaccgggacgcgaccgacgaccaggtcacgatcgac
gcggcgcacgccatccagaagcacggtgtgggcgtcaagtgcgccaccatcacgcccgac
gaggcgcgcgtggccgagttcggtctcaagaagatgtggaagagcccgaacggcacgatc
cgcaacatcctcggcggcgtcatcttccgcgagccgatcgtcatctccaacatcccgcgc
ctcgtgcccgggtggaacaagcccatcatcatcggccgccacgccttcggcgaccagtac
cgcgccaccgacttcgtgttcgacggcccgggcacgctgaccctctcgttccagcccgcc
gacggcggcgaggcgcagagcttcgaggtgttccaggccccggacggcggcgtcgcgatg
gcgatgtacaaccaggacccgtcgatccgcgacttcgcccgggcgagcttcaactacggc
ctctcgcgcggctacccggtgtacctctcgacgaagaacaccatcctgaaggcctacgac
ggccgcttcaaggacctcttccaggaggtcttcgacgccgagtacaaggagcggttcgag
gccgccggcatcacctacgagcaccgcctcatcgacgacatggtcgcctccgcgctcaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggcgacgtgcagtccgacacg
gtggcccagggctacggctcgctcggcctcatgacctcggtgctcaccacgcccgacggc
aaggtcgtcgaggcggaggccgcgcacggcaccgtgacgcgccactaccgccagcaccag
gcgggcaagcccacctcgaccaacccgatcgcctccatcttcgcgtggacccgcggcctc
atgcaccgcggcaagctcgacggcaaccaggcgctcatcgacttcgccgagacgctcgag
gacgtcgtcatcaagacggtcgagtcgggcaagatgacgaaggacctcgcgatcctcgtc
ggccccgagcaggagtggcagaccaccgaggacttcctcgcctccctcgacgagaacctc
gcggcgcgtctggcgtag

DBGET integrated database retrieval system