KEGG   Lysinimonas sp. 2DFWR-13: D7I47_05745Help
Entry
D7I47_05745       CDS       T05661                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
lyd  Lysinimonas sp. 2DFWR-13
Pathway
lyd00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lyd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    D7I47_05745
Enzymes [BR:lyd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     D7I47_05745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_2_C Glyco_hydro_14 Nre_C
Motif
Other DBs
NCBI-ProteinID: AYF97809
UniProt: A0A387BA41
LinkDB All DBs
Position
complement(1190849..1192867)
Genome map
AA seq 672 aa AA seqDB search
MNQNAWPLEGIAYGGDYNPEQWPRETWREDVALMREAGVTLVSVGIFSWALLETEEGVFD
FGWLDELLELLHAGGIRVDLGTPTASPPAWFFAKHPDARVVDRNGVVQGFGSRGMASPSS
PAYRAASVRIATELAKRYAEHPAVVMWHVHNEYGVPVGEDYSEQSAVAFRRWLEERYGDL
DGLNRAWGTAFWGQRYGSWEHVGVPAAAASVVNPAQRLDFARFTDHQLRQCFLAERDAIR
AHAAQPITTNFMANQSWTTDLWKWGEVVDIVADDSYPWAADTENEIGLAIASDLSRSVGG
GDPWILMEHSTSAVNWQPRNVAKRAGEMARNSLAHLGRGADAVLFFQWRASRSGAEKFHS
AMIPHAGTDSRLWREVVDLGAKLGRLGELQGSRVRADVALLWDFESFWAQDLEWRPSVEL
DHKERVRAFYERLWRDGITVDFALPTHDLSRYALVVAPAQYLLTAEGGANLTRYVEQGGT
LLVSFFSGIVDENDAVHAGGFGAPLAEVLGVKVEEFLPLREGVTTTVRWRGRELAADAWQ
EDLRVTTAEVLGVHRDGPGENGAAITRNVHGAGAAWYLSTRLDADGLAAVMAEVYADAGL
APAGQPDGVELVTRRGPDADYLIAINHRDTAAQLAASGRELLTDTPVEGVLELPGGTVAV
VRTPRDPLGGTA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccagaacgcctggcccctcgaggggatcgcctacggaggcgactacaaccccgag
cagtggccccgcgagacgtggcgcgaagacgtcgccctcatgcgggaagcgggcgtcacc
ctcgtctccgtcggcatcttctcctgggcgctcctcgagaccgaggagggcgtgttcgac
ttcggctggctcgacgagctgctcgagctgctgcacgcgggcggcatccgcgtcgacctc
ggcacccccacggcatccccgcccgcctggttcttcgcgaagcaccccgatgcgcgggtc
gtcgaccgcaacggtgtcgtgcagggcttcggatcgcgcggcatggcctccccgtcgtcg
cccgcctaccgtgcggcgagcgtgcgcatcgccaccgagctcgcgaagcgctacgccgag
caccccgccgtcgtcatgtggcacgtgcacaacgagtacggcgtgcccgtcggcgaggac
tactccgagcagtcggcggtcgccttccgccgctggctcgaggagcgctacggcgacctc
gacggcctcaaccgggcctggggcaccgccttctggggccagcgctacggctcctgggag
cacgtcggcgtgcccgccgccgccgcctccgtcgtcaaccccgcgcagcggctcgacttc
gcgcgcttcaccgaccaccagctgcgccagtgcttcctggccgagcgcgacgccatccgg
gcgcacgccgcgcagcccatcacgaccaacttcatggccaaccagtcctggacgaccgac
ctgtggaagtggggcgaggtcgtcgacatcgtcgcggacgactcctacccgtgggcggcc
gacaccgagaacgagatcgggctggcgatcgcctccgacctctcgcgctcggtcggcggg
ggtgacccgtggatcctcatggagcactccacgagcgccgtcaactggcagccgcgcaac
gtcgccaagcgcgccggcgagatggcccgcaactcgctcgcgcacctcgggcgcggggcg
gatgccgtgctgttcttccagtggcgcgcctcgcgctccggcgcggagaagttccactcg
gcgatgatcccgcacgccggcaccgactcgcggctgtggcgggaggtcgtcgacctcggc
gcgaagctcggccgcctcggcgagctgcagggcagccgggtgcgcgcggacgtcgccctg
ctctgggacttcgagtcgttctgggcgcaggacctcgagtggcgcccctcggtcgagctc
gaccacaaggagcgggtgcgcgccttctacgagcggctctggcgcgacggcatcacggtg
gacttcgcgctgccgacgcacgacctctcgcgctacgcgctcgtcgtcgccccggcgcag
tacctgctcacggcggagggcggcgcgaacctcacccgctacgtcgagcagggcggcacc
ctgctcgtctccttcttctccggcatcgtcgacgagaacgacgccgtgcacgcgggcgga
ttcggcgccccgctcgccgaggtgctgggcgtgaaggtggaggagttcctgcccctgcgc
gaaggggtcaccaccaccgtccggtggcgcggacgcgagctcgccgccgacgcgtggcag
gaggacctgcgcgtgacgaccgccgaggtgctcggcgtgcaccgcgacggcccgggcgag
aacggcgccgcgatcacccgcaacgtccacggcgccggtgccgcctggtacctcagcacc
cgcctcgacgccgacggcctcgcggccgtcatggccgaggtgtacgcggatgccgggctc
gcgcccgccgggcagccggacggggtcgagctggtcacccgccgcggccccgacgccgac
tacctcatcgcgatcaaccaccgcgacaccgcggcgcagctcgccgcatccggtcgggag
cttctgaccgacacgcccgtcgagggcgtcctcgaactccccggcggcaccgtcgccgtc
gtgcgcaccccgcgcgatcccctgggaggtaccgcctga

DBGET integrated database retrieval system