KEGG   Lysinibacillus sp. SGAir0095: C1N55_11905Help
Entry
C1N55_11905       CDS       T06028                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
lyg  Lysinibacillus sp. SGAir0095
Brite
KEGG Orthology (KO) [BR:lyg00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    C1N55_11905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE Syndecan
Motif
Other DBs
NCBI-ProteinID: QCR32834
UniProt: A0A4P8SG48
LinkDB All DBs
Position
2417473..2418237
Genome map
AA seq 254 aa AA seqDB search
MEIDLMKAIIVIFFGFVGAFINATVGGGGLITLPALLSVGLPPSAAIATNKLAASMGNLT
SSLTFFKAGKVDIKLLGPILPFVFIFSMLGAWTVHLIDSELLRPLIIIMLIVVLIYTLLK
KNWGQLEERKPLNWKRGTLFVAGILLLGFYDGFFGPGTGSFIMFIFLIAGFDFLQAAGNA
KLLNFISNIAALIMFLILGEVVFTYGFIMGISMIAGAFFGTKFALSKGTSFVRMLFIIMT
VVLIIKNSYDSIFA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagatttaatgaaagcaataatcgttatcttttttggctttgtgggggctttt
ataaatgctacagtaggtggagggggtttgatcactcttcccgccctattatctgtaggc
ctccctccttcagctgccattgcaactaataaactagcagcttccatgggaaacttaaca
agctctttaacgttttttaaagctggtaaggtagatatcaaactactaggtcctattctc
ccttttgtctttattttctccatgctaggtgcttggacagtgcatttaatagattcagag
cttttaagaccattaattatcattatgttgatcgtcgtattaatttatacactcttaaag
aaaaattgggggcagttagaggagagaaaaccattaaattggaagcgaggcacactcttt
gttgctggtattctattattaggattctatgatggtttttttggaccaggtacaggttcc
tttatcatgttcatctttttaattgcaggatttgattttttacaagctgcaggtaatgcg
aaactgttaaactttataagtaatattgcagccctcattatgtttttaattttaggggaa
gtagttttcacttatggattcataatggggatttcaatgattgctggtgctttctttggt
acgaaatttgcccttagtaaagggaccagctttgtgagaatgttatttatcatcatgacg
gtcgttttaattattaaaaatagttatgattctatttttgcataa

DBGET integrated database retrieval system