KEGG   Lysinibacillus sp. SGAir0095: C1N55_20155Help
Entry
C1N55_20155       CDS       T06028                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lyg  Lysinibacillus sp. SGAir0095
Brite
KEGG Orthology (KO) [BR:lyg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C1N55_20155
Enzymes [BR:lyg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C1N55_20155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like FAD_binding_3 Thi4 DAO NAD_binding_7 AlaDh_PNT_C Glutaredoxin K_oxygenase NAD_binding_8 FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QCR34288
UniProt: A0A4P8S8I6
LinkDB All DBs
Position
4089717..4091246
Genome map
AA seq 509 aa AA seqDB search
MLLDAEIKAQLAQYLQLMEGDVLLKVSAGNDDISRDMLALVDELTTMSKHIKVENAQLNR
TPSFSVNRIGEDTGITFAGIPLGHEFTSLVLALLQVSGRAPKVDQKVIDQVKSIQGEYHF
DSYISLTCHNCPDVVQALNVMSVLNPNITHTMIDGAAFKEEVESKDIMAVPTVFLNGEPF
GNGRMTLEEILAKVGSAPDASEFADKEPFDVLVVGGGPAGASAAIYSARKGIRTGIVAER
FGGQIMDTLGIENFIGTKYTEGPKLAASLEEHVKEYEIDVMNLQRAKRLEKKDLIEIELE
NGAVLKSKTVILSTGARWRNVNVPGEAEFKNKGVAYCPHCDGPLFAGKRVAVIGGGNSGV
EAAIDLAGIVKHVTVLEYSNALKADSVLQDRLNSLSNVTVIKNAQTTEITGADKVNGISY
KDQETEQIHHIELEGIFVQIGLVPNTDWLSDEVERTRMGEIIVDKHGSTSIPGVFAAGDC
TDNPFKQIIISMGSGANAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttattagatgcagagatcaaagcacaactagcccaatatcttcaactgatggaaggc
gatgtgctacttaaagtaagtgcgggaaatgatgatatttcccgcgatatgttggcttta
gtagatgaattaactactatgtccaaacatattaaagtcgaaaatgcccaattaaataga
acaccaagctttagcgtaaatcgcatcggggaagatactggcatcacatttgctggtatt
ccacttggacatgaatttacatctttagttttagcactacttcaagttagcggaagagcc
ccaaaggtagatcaaaaggtcattgatcaggtaaaaagtattcaaggagaataccacttt
gactcttatatcagtttgacatgccataattgccctgatgttgttcaagctcttaacgta
atgagcgttcttaaccctaatattactcatacgatgattgatggggcagcttttaaagaa
gaagtcgaaagcaaagacatcatggctgtaccaactgtattcttgaatggagaacctttc
ggcaatggtcgtatgaccctggaggagatccttgccaaggttggcagcgcaccagacgca
tccgagtttgctgacaaagagccatttgatgtccttgttgttggcggcgggcctgctggt
gcaagtgctgccatctattctgcacgtaaaggtatccgtacaggaattgtggcagaacgc
tttggtggccaaataatggatacactaggcattgaaaactttattggtacaaaatatact
gagggtcctaaactcgcggcaagcttggaagagcatgtgaaagaatacgagattgatgta
atgaatcttcagcgtgctaaacgtctagaaaagaaagatttaatcgaaattgagctcgaa
aatggagcagttctaaaaagcaaaacggtcattctttcaactggtgctcgttggcgtaat
gtgaacgtaccaggagaagcagaatttaaaaacaaaggggtagcctactgcccacattgt
gatggtcctttatttgctggaaaacgagtggccgttatcggtggtggaaactcaggtgtt
gaagctgccattgacctagcgggaattgtgaaacatgtaacagttcttgaatattcaaat
gcattaaaagcggactctgtcctgcaagatcgtttaaatagtctgtcaaacgtaacggtt
atcaaaaatgcacaaacaactgaaattacaggcgctgataaagtaaatgggatttcatac
aaagatcaagaaacagaacaaatccatcatattgaacttgaagggattttcgttcagatt
ggtcttgtaccaaatacagactggttaagtgatgaagttgaacgtacacgtatgggtgaa
ataattgtagataagcatggctctacaagcatcccaggtgtatttgctgctggtgattgt
acagataacccatttaaacaaattattatttcaatgggatcaggtgcaaatgcagcttta
ggtgcttttgattacctaatccgtaactaa

DBGET integrated database retrieval system