KEGG   Lysobacter sp. SJ-36: FKV23_12160Help
Entry
FKV23_12160       CDS       T06167                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lyj  Lysobacter sp. SJ-36
Brite
KEGG Orthology (KO) [BR:lyj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FKV23_12160 (ahpF)
Enzymes [BR:lyj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FKV23_12160 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 AlaDh_PNT_C DAO NAD_binding_7 Glutaredoxin FAD_binding_3 Thi4 K_oxygenase FMO-like Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: QDH70750
UniProt: A0A514BTN2
LinkDB All DBs
Position
2760795..2762381
Genome map
AA seq 528 aa AA seqDB search
MLDAALKTQLKAYLEKVTQPIELVASLDDSAKSQELDALLRDIVGLSDKVAYSRNGDDAR
KPSFAIRRIGTDVQVAFAGLPMGHEFTSLVLALLQVGGHPPKLDDEVIEQIRNIEGKFTF
ETYFSLSCQNCPDTVQALNLMSVINPNIKHTSIDGALFQAEVEARQVMSVPTVLLNGEVF
DTGRMSVEQILAKIDTGAADRAAEQIKAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGIA
AERFGGQVLDTMAIENFISVPHTEGPKLAAALEQHVKDYEVDVMNLQRAEALVPADDDGL
VEVKLANGASLKSRTVILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEFDGKLRADEVLQRKLRSLPNVDIIVSAQTTEVFGDGQ
KVTGLAYKDRVGGDLHRIDLEGVFVQIGLLPNTEWLKGTVELSPRGEIVIDARGQTSVPG
VFAAGDATTVPYKQIVIAMGAGSTAALAAFDHLIRTSAPAEVKEAEAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccgcactcaagacccagttgaaggcctaccttgaaaaggtcacgcagccg
atcgagctggtggcctcgctcgacgacagcgccaagtcgcaggagctcgacgccctgctg
cgcgacatcgtcgggctgtccgacaaggttgcctactcacgcaacggcgacgatgcgcgc
aagccgtcattcgcgatccgccgcatcggcaccgatgtccaggtcgccttcgccgggctg
ccgatgggccacgagttcacctcgctggtgctggcgctgctgcaggtcggcggccacccg
cccaagctcgatgacgaagtgatcgaacagatccgcaacatcgaaggcaagttcacgttc
gagacctatttctcgctgtcctgccagaactgcccggacaccgtgcaggcgctcaacctg
atgagcgtgatcaaccccaacatcaagcacacctcgatcgacggcgcgctgttccaggcc
gaggtcgaggcacgccaggtcatgtcggtgccgaccgtgctgctcaacggcgaggtgttc
gacaccggccgcatgagcgtcgagcagatcctcgcgaagatcgacaccggtgccgccgac
cgcgccgccgagcagatcaaggcgaaggacgcattcgacgtgctggtcgtcggcggcggc
ccggccggcgccgcggccgcgatctacgccgcccgcaagggcatccgcaccggcatcgcc
gccgagcgtttcggcggccaggtgctcgacaccatggcgatcgagaacttcatctcggtc
ccgcacaccgaaggcccgaagctggccgccgcgctggaacagcacgtcaaggactacgag
gtcgacgtgatgaacctgcagcgcgccgaggcattggttccggctgacgacgatggtttg
gtcgaggtgaagctcgccaacggcgcctcgctgaaatcacgcacggtgatcctgtccacc
ggcgcacgctggcggcagatgggcgtgcccggcgaggacgagtaccgcaacaagggcgtg
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgggtggcggtgatcggc
ggcggcaactccggcgtcgaggcggcgatcgatctggccgggatcgttgcccacgtcacc
ctgatcgagttcgacggcaagctgcgcgccgacgaggtgctgcagcgcaagctgcgcagc
ctgcccaacgtcgacatcatcgtcagtgcgcagaccaccgaagtgttcggcgacggccag
aaagtcaccggactggcctacaaggaccgcgtcggcggcgacctgcaccgcatcgacctg
gagggcgtgttcgtgcagatcggcctgctgcccaacaccgaatggctgaagggcaccgtg
gaactgagcccgcgcggcgagatcgtcatcgacgcacgcggccagaccagcgtgccgggc
gtgttcgcagcaggcgatgcgaccaccgtgccgtacaagcagatcgtgatcgcgatgggc
gccggctcgaccgccgcactcgccgccttcgaccacctgatccgtacctcggccccggcc
gaggtgaaagaagcggaggcagcatag

DBGET integrated database retrieval system