KEGG   Lysinibacillus sp. YS11: LBYS11_08075Help
Entry
LBYS11_08075      CDS       T05299                                 

Definition
(GenBank) sodium ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
lys  Lysinibacillus sp. YS11
Brite
KEGG Orthology (KO) [BR:lys00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lys02000]
    LBYS11_08075
Transporters [BR:lys02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    LBYS11_08075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_23 AAA_22 AAA_27 SbcCD_C TssC RsgA_GTPase AAA_29
Motif
Other DBs
NCBI-ProteinID: AUS86294
UniProt: A0A2I7Z1V3
LinkDB All DBs
Position
1702285..1703190
Genome map
AA seq 301 aa AA seqDB search
MTLQLQQVTKKYKDFTAVDDLNFTIEKGEIFGLIGQNGAGKTTTFRMILDLQETTAGTIT
WDGQPVNAINRDVLGYLPEERGIFPSMKVEEQLYFFGELRGMKRAELKKEIDFWIQRFEL
EEKRKDKAETLSKGNQQKVQLIASFIHKPAFLILDEPFSGLDPVNKDLLKDAILLLKEQG
TTILFSSHQMDNVEELCDHLCLLKRGVSLFSGSLLDLKKQYGKTKLAVRTDWSTTQLLAL
EGVKDVRVEKEQTVLTLVDESFAQGIFEQLSNGKYIEKFSLDYLSLDEIFKDKVGGHVVE
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacattacagttacagcaggtcacaaagaagtacaaggattttacagctgtagatgat
ttaaattttaccattgaaaaaggggaaattttcggtctaattggtcaaaatggtgcagga
aaaacaacgacattccgaatgattttagatttacaggagacgacagcggggacgattact
tgggatgggcagccagttaatgccattaaccgagatgtccttggttatttaccagaggag
cgtggtattttcccatcaatgaaggtagaggagcagctttacttttttggtgagctacgt
ggcatgaaacgagcagagctgaaaaaggaaatagatttttggattcaacgctttgaactg
gaggaaaaacgcaaggataaggcagaaacactgtcaaaggggaatcagcaaaaggtacag
ctaattgcaagctttatccataaacctgcgtttttaattttagatgagccgttcagtggg
ctagatcccgtcaataaagatttactaaaggatgctattttactattgaaagagcaaggc
acgacgattttgttctccagtcaccaaatggacaatgtcgaggagctttgtgatcatttg
tgtttattaaaacgaggtgtttctttattttctggaagcttactagatttaaagaaacaa
tatggtaaaacaaagcttgctgtccgtacggattggtcaacaacacaattattggcactt
gagggtgtcaaggatgtgcgtgtagagaaggagcaaacagtgcttacattagtggacgaa
agctttgctcaaggtatctttgagcagctatccaatgggaagtatattgaaaaattcagc
ttagattatttatcgttagatgaaatctttaaagataaggtaggtggccatgttgtcgaa
gtttag

DBGET integrated database retrieval system