KEGG   Lysinibacillus sp. YS11: LBYS11_14765Help
Entry
LBYS11_14765      CDS       T05299                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lys  Lysinibacillus sp. YS11
Pathway
lys00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBYS11_14765
Enzymes [BR:lys01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LBYS11_14765
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LBYS11_14765
    1.1.1.-  
     LBYS11_14765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N F420_oxidored ADH_N_assoc Methyltransf_24 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AUS87515
UniProt: A0A2I7Z5C1
LinkDB All DBs
Position
2969971..2971026
Genome map
AA seq 351 aa AA seqDB search
MKAARWYKAKDIRVENIEEPVIAPGKVKIKVHWTGICGSDLHEYAAGPIFIPVEQPHYVS
KDIAPIVMGHEFSGEVVEIGDGVTSVKIGDPVVVEPILACGECAACKKGKYNICKHLGFH
GLSGGGGGFSEYTMVDEKMVHKMPEGLSYEQGALVEPAAVALHAVRQSKLKAGDKAAVFG
TGPIGLLVIEALRAAGASEIYAVELSAERAAKALELGATAVINPKEEDAVARLHELTNGG
VDVAFEVTGVPVVLQQAIDSTTFEGETIIVSIWESTAAIQPNNIVLSERTVKGIIAYRDI
FPAVMELMTQGYFPADKLVTKRIALDEVVTEGFEALMKERNHIKILVNSQA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaagatggtataaagcaaaagacatccgtgtagaaaacattgaagaacca
gtcatcgcacctggaaaagtaaaaatcaaagtacattggacaggaatttgtggcagtgat
ttacatgaatacgcagctgggccaatctttattccagtggagcaacctcactatgtaagt
aaagacatcgcacctattgtaatgggacatgaattttcaggtgaagtagttgaaattggc
gatggtgttacatctgttaaaatcggtgatcctgtagtagtagaaccaatccttgcatgt
ggcgaatgtgctgcctgtaaaaaaggtaaatataatatttgtaaacatttaggttttcac
ggtctttcaggcggtggcggtggattctccgaatatacaatggtagatgaaaaaatggtt
cacaaaatgccagaagggctttcttatgagcaaggagcacttgttgaaccagcagcagtc
gctttacatgctgtgcgtcaaagtaaattaaaagccggtgacaaagctgccgtctttgga
acaggaccaatcgggctacttgtcattgaagcattacgtgcagcgggcgcatcagaaatc
tatgctgtagagctttcagcagagcgtgccgcaaaagctttagaacttggtgcaacagcc
gtcattaatcctaaagaggaagatgccgttgcgcgtctacatgaattaacaaatggtggt
gtagatgttgcctttgaagtaacgggcgttcctgtggtattacaacaagctattgactca
acaacttttgaaggtgaaacaatcatcgtgtcgatttgggagtctacagctgctatccaa
ccgaacaatatcgttctatcagagcgaacagtcaaaggaattattgcctaccgcgatatt
ttcccagccgtaatggagctgatgacccaaggttacttccctgcagacaagcttgttacg
aaacgaattgctcttgatgaagtggtaacagaaggctttgaggcattaatgaaggaacgt
aatcatattaaaattcttgtaaattctcaagcataa

DBGET integrated database retrieval system