KEGG   Lysinibacillus sp. YS11: LBYS11_18925Help
Entry
LBYS11_18925      CDS       T05299                                 

Definition
(GenBank) imidazoleglycerol-phosphate dehydratase HisB
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
lys  Lysinibacillus sp. YS11
Pathway
lys00340  Histidine metabolism
lys01100  Metabolic pathways
lys01110  Biosynthesis of secondary metabolites
lys01230  Biosynthesis of amino acids
Module
lys_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lys00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    LBYS11_18925
Enzymes [BR:lys01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     LBYS11_18925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD Asp23
Motif
Other DBs
NCBI-ProteinID: AUS88248
UniProt: A0A2I7Z7J7
LinkDB All DBs
Position
complement(3768292..3768891)
Genome map
AA seq 199 aa AA seqDB search
MTEKKRYAKIERTTNETQISVAIDLDGEGKADIQTGVGFMDHMLDLFIKHGLFNGTIHAN
GDTYIDDHHTTEDLGIVLGQAVREALGDKKGIKRYGNAFVPMDDALAQVVVDCSNRPHLE
YRVPALKEKVGTFDTELVHEFLWKFALEARMNVHVIVPYGQNTHHIIEAIFKALARAIDA
AVEIDPRVKGVPSTKGLLT
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaagaaacgatatgcaaagatagagcgtacaacgaatgaaacgcaaatttct
gtagcaattgatttagatggtgaaggcaaggcagatatccaaacaggcgtgggatttatg
gaccatatgcttgacttatttattaagcatggactatttaacggcacaatacatgcaaat
ggcgatacttatattgatgatcaccatacaacagaggaccttggtattgtattaggacag
gctgttcgagaagcacttggtgataagaaaggcataaaacgctatggtaacgcctttgta
ccgatggatgacgcactagctcaggtagtggtcgattgctcgaatcgacctcatctagag
taccgtgtgccagcattaaaagaaaaagtaggaacgtttgatacagaattagtgcatgaa
tttttatggaaatttgcccttgaggcaaggatgaatgttcatgtaattgtaccttatgga
caaaatacacatcacattattgaggcaattttcaaagcattagcacgtgcgattgatgcc
gcagtggaaattgacccgcgtgttaaaggcgtaccatcgactaaggggctgttgacgtga

DBGET integrated database retrieval system