KEGG   Lysobacter sp. TY2-98: DWG18_04235Help
Entry
DWG18_04235       CDS       T05586                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
lyt  Lysobacter sp. TY2-98
Pathway
lyt00061  Fatty acid biosynthesis
lyt00780  Biotin metabolism
lyt01100  Metabolic pathways
lyt01212  Fatty acid metabolism
Module
lyt_M00083  Fatty acid biosynthesis, elongation
lyt_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:lyt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DWG18_04235 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DWG18_04235 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lyt01004]
    DWG18_04235 (fabZ)
Enzymes [BR:lyt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     DWG18_04235 (fabZ)
Lipid biosynthesis proteins [BR:lyt01004]
 Fatty acid synthase
  Component type
   DWG18_04235 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AXK71576
UniProt: A0A345ZIK1
LinkDB All DBs
Position
complement(875047..875514)
Genome map
AA seq 155 aa AA seqDB search
MNQTVQLPVDVRGIEALLPHRYPFLLVDRVVAFEPRKRILAYKNVTANEPCFTGHFPGNP
VMPGVLIIEALAQAGGLLTTLTAKSEGAGPQDEKLFYLVKVDGAKFMKQVVPGDRIELDV
ELKRVIRNMAMYAGVARVDGEVVACAEILCAEAQR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaccgtgcagctccccgtcgacgtccgcggtatcgaagcccttctgccgcac
cgctatccgttcctgctggtggatcgcgtcgtcgcgttcgagccccgcaagcgtatcctc
gcgtacaagaacgtcaccgcgaacgagccgtgcttcaccggccatttcccgggcaacccg
gtcatgcccggcgtgctgatcatcgaggcgctggcgcaggccggcggcctgctgacgacg
ctcaccgcgaagtcggaaggtgcgggtccgcaggacgagaagctgttctatctggtcaag
gtggacggcgcgaagttcatgaagcaggtggtgccgggtgaccgcatcgaactcgacgtc
gaactcaagcgcgtgatccgcaacatggcgatgtacgccggcgtcgcgcgcgtggacggc
gaagtcgtcgcctgcgccgagatcctctgcgccgaggcgcagcgctga

DBGET integrated database retrieval system