KEGG   Lysobacter sp. TY2-98: DWG18_09590Help
Entry
DWG18_09590       CDS       T05586                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
lyt  Lysobacter sp. TY2-98
Pathway
lyt00260  Glycine, serine and threonine metabolism
lyt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lyt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DWG18_09590
Enzymes [BR:lyt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     DWG18_09590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 2-Hacid_dh_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AXK73656
UniProt: A0A345ZPI1
LinkDB All DBs
Position
1986117..1987139
Genome map
AA seq 340 aa AA seqDB search
MRALVKREAAKGIWMEEVPVPVPSPNEVLIKLEKTAICGTDLHIYMWDEWSQRTIKPGLV
IGHEFVGRIAALGTGVTGYSVGQRVSAEGHIVCGHCRNCRAGKQHLCPNTVGIGVNRNGA
FAEYIVMPASNLWPIPDQIPSELAAFFDPYGNAAHCALEFDVVGEDVLITGAGPIGIIAA
GICKHIGARNVVVTDVNDYRLKLAADMGATRVVNVANTSLKDVMKDLHMEGFDVGLEMSG
NPRAFNDMLDCMYNGGKIAMLGIMPKGAGADWDKIIFKGLTLHGIYGRRMYETWYKMTQL
VLSGFPLGKVLTHQLPVDRFQEGFDLMEAGKSGKIVLSWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccctcgtgaagcgcgaagccgccaagggcatctggatggaggaggtgccggtg
ccggtgcccagcccgaacgaggtgctgatcaagttggagaagaccgcgatctgcggcacc
gacctgcacatctacatgtgggacgagtggagccagcgcacgatcaagccgggcctggtg
atcggtcatgaattcgtcggccgcatcgcggcgctcggcaccggcgtgacgggctacagc
gtcggccagcgcgtgtcggccgaaggccacatcgtctgcggccactgccgcaactgccgc
gcgggcaagcagcacctctgccccaacacggtcggcatcggcgtgaaccgcaacggcgcg
ttcgcggaatacatcgtgatgccggcttcgaacctgtggccgatcccggaccagatcccg
agcgagctggccgcgttcttcgatccttacggcaacgccgcgcactgcgcgctggaattc
gacgtcgtcggcgaagacgtcctgatcaccggcgcaggcccgatcggcatcatcgccgcg
ggcatctgcaagcacatcggcgcccgcaacgtcgtcgtcaccgacgtcaacgactaccgc
ctgaagctcgccgcggacatgggcgcgacgcgcgtggtcaacgtcgcgaacacctcgctc
aaggacgtcatgaaggacctccacatggagggcttcgacgtcggcctcgagatgagcggc
aatccacgcgcgttcaatgacatgctcgactgcatgtacaacggcggcaagatcgcgatg
ctcggcatcatgcccaagggcgccggcgccgactgggacaagatcatcttcaaggggctc
acgctgcacggcatctacggccgccgcatgtacgagacctggtacaagatgacgcagctc
gtgctcagcggcttcccgctcggcaaggtgctgacgcatcagttgcccgtcgaccgtttc
caggaaggcttcgacctgatggaagccggcaagagcggcaagatcgtcctgagctggaac
tga

DBGET integrated database retrieval system