KEGG   Lysobacter sp. TY2-98: DWG18_10125Help
Entry
DWG18_10125       CDS       T05586                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lyt  Lysobacter sp. TY2-98
Brite
KEGG Orthology (KO) [BR:lyt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DWG18_10125
Enzymes [BR:lyt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DWG18_10125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored Glutaredoxin AlaDh_PNT_C DAO FAD_binding_3 NAD_binding_7 Thi4 K_oxygenase Thioredoxin_4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AXK73659
UniProt: A0A345ZPI4
LinkDB All DBs
Position
2082692..2084272
Genome map
AA seq 526 aa AA seqDB search
MLDESLKSQLAAYLERLQQPIRLEASLDESDAARELEALLRDIATLSDKVEYVRTDDDAR
KPSFGIVRAGTDIDVRFAGIPLGHEFTSLVLALLWVGGHPPKIEDDVAHQVRELEGEFRF
ETYMSLSCQSCPDTVQALSLMSVLNPNIKHVAIDGALHQAEVEARGIMSVPTIFLNGEQF
DQGRLTVEQILAKLDTGAASRAAESIAKKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFVSMSYTEGPKLATALEQHVRDYEVDVMNLQRASKLHPAGADGL
ITVDLENGASLKAKSVIVTTGARWRQMGVPGEEQYRNRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGLVAHVTLIEFDSKLRADDVLQRKLRSLPNVDVITNGQTTEVLGDGA
KVTGLVVKDRASNESRTIELEGVFVQIGLLPNTEWLKGSIELTPRGEVVIDDRGATSVPG
VFAAGDATTVPYKQIVIAMGAGATAALSAFEHLIRSSAPAEQAQAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgaaagcctgaagtcccagctcgccgcctacctcgaacgcctgcagcagccg
atccggctagaagcgtcgctcgacgagtccgacgccgcgcgcgaactcgaagcgctgctg
cgcgacatcgccacgctgtccgacaaggtcgagtacgtgcgcaccgacgacgacgcgcgt
aagccgtcgttcggcatcgtgcgcgccggcaccgacatcgacgtgcgcttcgccggcatt
ccactcggccacgaattcacctcgctggtgctcgcgttgctgtgggttggtggccatccg
ccgaagatcgaggacgacgtcgcgcaccaggtgcgtgagctcgaaggcgagttccgcttc
gagacctatatgtcgctgtcgtgccagagctgcccggacaccgtgcaggcgctgagcctg
atgagcgtgctgaatccgaacatcaagcacgtcgcgatcgacggcgcactgcatcaggcc
gaagtcgaagcgcgcggcatcatgtcggtgccgacgatctttctcaacggcgagcaattc
gaccagggccgcctgacggtcgagcaaatcctcgcgaagctcgacaccggtgcggcgtcg
cgcgcggcggagtccattgcgaagaaggacgcgttcgacgtgctcgtcgtgggtggcggc
cccgccggcgccgcagcggcgatctacgcggcgcgcaagggcatccgcaccggcgtcgcg
gccgagcgtttcggcggccaggtgctcgacaccatggccatcgagaacttcgtctcgatg
tcgtacaccgaaggcccgaagctcgcgacggcgctcgagcagcacgtgcgcgactacgaa
gtggacgtgatgaatctgcagcgcgcgtcgaagctgcatccggcaggtgccgacgggctg
atcaccgtggatctcgaaaacggcgcttcgctcaaagcgaagtcggtgatcgtcaccacc
ggtgcccgctggcggcagatgggcgtgcccggcgaagagcaatatcgcaacaggggcgtg
gcctattgcccgcactgcgacggcccgctgttcaagggcaagcgtgtcgcggtgatcggt
ggcggcaattccggcgtggaagcggcgatcgatctcgcaggcctcgtcgcgcacgtgacg
ctgatcgagttcgattcgaagctgcgcgcggacgacgtgctgcagcgcaagctgcgcagc
ctgccgaacgtcgacgtcatcaccaacggccagaccaccgaagtgctgggtgacggcgcc
aaggtgacggggctcgtcgtgaaggatcgcgcgtccaacgaatcgcgcacgatcgagctc
gaaggcgtgttcgtgcagatcggcctgctgcccaacaccgagtggctcaagggcagtatc
gaactcaccccgcgcggcgaggtcgtgatcgacgatcgcggtgcgaccagcgtgccgggc
gtattcgccgcgggcgacgccacgaccgtgccgtacaagcagatcgtgatcgcgatgggt
gcaggtgcgacggcggcgctgagtgcgttcgagcacctgatccgctcgtcggcgccggcg
gagcaggcgcaggctgcgtaa

DBGET integrated database retrieval system