KEGG   Lysobacter sp. TY2-98: DWG18_14240Help
Entry
DWG18_14240       CDS       T05586                                 

Definition
(GenBank) superoxide dismutase family protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lyt  Lysobacter sp. TY2-98
Brite
Enzymes [BR:lyt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DWG18_14240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AXK73737
UniProt: A0A345ZPR2
LinkDB All DBs
Position
2958335..2958922
Genome map
AA seq 195 aa AA seqDB search
MKTCLAVMTSTLLLAGCASTAPAPAPSTSPSSAPVASVGVAMPPVNSAVIALAPASGSLV
SGRLSAMAMTDGVHITGDIGGLAPNSTHGLHVHEKGDCSAADATSAGPHFNPAGKPHGNP
SAGTHHAGDLPNITAGSDGVAHVNLHVAGVSLGGAAGTNILGRALVVHGSADDYTSQPAG
NSGPRIACGVVRAGG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaagacatgccttgccgtgatgacctccacgctgctgctcgccggatgcgcgagcacc
gcgcctgcacccgcaccgtcgacgtcgccctcgtccgcaccggtcgcaagcgtcggcgtc
gcgatgccgccggtgaattccgcggtgatcgcgctcgcgcccgcgtcgggttcgctggtc
agcggtcgcctgagcgcaatggcgatgactgacggcgtgcatatcaccggcgacatcggt
ggcctcgcgccgaacagcacgcatggcctgcacgtgcacgagaagggcgactgcagcgcg
gccgatgcgacgagtgcaggcccgcacttcaatcccgccggcaagccgcacggcaatccg
tccgcgggaacgcatcacgccggcgacctgccgaacatcaccgcgggcagcgacggcgtc
gcgcacgtgaacctgcacgtcgctggcgtatcgctcggcggcgccgcggggacgaacatc
ctgggtcgcgcgctggtcgtgcacggttcggccgacgactacacctcgcagcctgcgggc
aattccggcccgcgcatcgcttgcggcgtcgtccgcgcgggcggctga

DBGET integrated database retrieval system