KEGG   Lysinibacillus sp. 2017: DCE79_02835Help
Entry
DCE79_02835       CDS       T05455                                 

Definition
(GenBank) flagellar hook-associated protein FlgL
  KO
K02397  flagellar hook-associated protein 3 FlgL
Organism
lyz  Lysinibacillus sp. 2017
Pathway
lyz02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:lyz00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    DCE79_02835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:lyz02035]
    DCE79_02835
Bacterial motility proteins [BR:lyz02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    DCE79_02835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C Spectrin Cucumo_coat DUF2408 MerR-DNA-bind DUF3375 Uso1_p115_C
Motif
Other DBs
NCBI-ProteinID: AWE06383
UniProt: A0A2S1GY98
LinkDB All DBs
Position
647091..647978
Genome map
AA seq 295 aa AA seqDB search
MRVTQSMLSSNLLRNLNTSYTKMSKLQEQIESGSIISRPSDDPVVAVKGMGYRVDIDKIE
QYQRNIGEVNTWIDTTDDALDQVGTSLIRVQELVTQAANDSNTDDERKKIEAEIDQIQQQ
IRDIANTKVGENYIFSGTNTNTPLYTDTKAGTMQTGTGLAETITINVFDGVTMQVNIEGE
DFFSKIDTMMTDVSNALKKTDSSGQEIGDLLNRIQGQSNVVLEQRAVVGARQNRAELMAN
RLSMQEINVTKQMSNNEDTDYSKAITEMTTAESIHQASLSVGAKIIQQTLVDFIR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttacacaatcaatgctatcgagcaatttgcttcgaaacctgaatacaagctac
accaagatgagtaaactccaagaacaaattgaatcagggagcattattagtcgcccatct
gatgacccagtagtcgcagtaaaaggaatgggctatcgcgtagatatagataaaatcgaa
caatatcagcgtaatattggagaagtaaacacatggatcgatacaacggatgatgcatta
gatcaagttggtacatcgttaattcgtgtgcaagaattagtgacacaagcagcaaatgat
tcgaatacggatgatgaacgtaaaaaaatcgaagctgaaattgatcaaattcaacaacaa
atccgagatatcgctaatacgaaagtcggagaaaactatattttttcagggacaaatacg
aatacaccactttatacggatacaaaagcaggtactatgcaaactggtacaggtttggca
gaaacaattacaattaatgtgtttgacggtgtaacaatgcaagtaaatatcgaaggagag
gactttttttcaaaaatcgatacaatgatgacagatgtatcgaatgcattaaaaaaaaca
gattcttcaggccaagaaattggcgatttacttaatagaattcaaggacaatctaatgta
gtattagaacaacgtgcagttgttggtgcaagacaaaatcgtgcagagttaatggcaaac
cgcctatctatgcaggaaatcaatgtaacaaagcagatgtctaataacgaagacacagat
tactcaaaagcaattacagaaatgacaacagccgaatcaatccaccaagcctctctttcg
gttggtgctaaaattattcaacagactttagtagatttcatccgttaa

DBGET integrated database retrieval system