KEGG   Lysinibacillus sp. 2017: DCE79_11465Help
Entry
DCE79_11465       CDS       T05455                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lyz  Lysinibacillus sp. 2017
Brite
KEGG Orthology (KO) [BR:lyz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DCE79_11465
Enzymes [BR:lyz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DCE79_11465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored Thi4 DAO K_oxygenase NAD_binding_8 FAD_binding_3 FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AWE07969
UniProt: A0A2S1H3U9
LinkDB All DBs
Position
2359501..2361030
Genome map
AA seq 509 aa AA seqDB search
MALDAEIKSQLNQYLQMLENDIVLKVSLGSDKVSDEVLALINELASMSSKITVENVELVR
TPSFSVNRVGEDTGVTFAGVPLGHEFTSLVLALLQVSGRAPKIDQNVIDQIKKIDGEYHF
ETYVSLTCHNCPDVVQALNIMSVLNQNITHSMIDGAAFKKEVESKDILAVPAVYLNGAPF
GNGRMTIDEILAKLGTGPKTEELSNKEPYDILVIGGGPAGSSAAIYSARKGIRTGIVAER
FGGQILDTLTIENFISVKETEGPKLAQALEEHVKDYNIDVMNLQRAKRLEKKEFVEVELE
NGAILKSKAIIISTGARWRNLNVPGEEKFKNKGVAYCPHCDGPLFAGKDIAVVGGGNSGI
EAAIDLSGIVHHVTVLEFGAELKADDVLKKRLLSLSNVTVLTNAQTTEITGDEKVNGLTY
VDRESGKEKQLELAGVFVQIGLIPNTDWLDGILERNKIGEIIVDKRGATTIPGVFAAGDC
TDSAYNQIIIAMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtggcacttgatgcagaaatcaaatctcaattaaatcagtacctacaaatgttagaaaac
gatatcgtgctcaaagtaagcttaggctctgacaaagtttccgacgaggtgctagctcta
attaatgagctagcttctatgtcatctaaaattacagtagaaaatgtagaactcgtgaga
acacctagctttagcgttaatcgcgttggagaagataccggtgttacttttgctggagtc
cctttaggtcatgaatttacctctttggtgttagctttgcttcaagtaagcggacgcgca
ccaaagatagatcaaaatgttattgatcaaattaaaaaaattgatggtgagtatcacttt
gaaacatatgttagtttaacttgtcacaattgtcctgatgttgtccaagccttaaatatc
atgagtgtactaaatcaaaacattacacactctatgatagatggcgcagcattcaagaaa
gaagtggaaagcaaagatattttagctgtccccgctgtctatttaaatggtgcgccattt
ggaaatggtcgtatgacgattgatgaaatcctagctaaattaggtactggtccaaagaca
gaagaactttcaaacaaagaaccatacgatatccttgttataggtggcggtcctgcagga
tctagtgcagctatctattcagcacgtaaaggaattaggacaggtattgtagcagaacgt
tttggtggccaaattttagatacactaacaatagaaaattttattagtgtaaaagagacg
gaaggaccaaaacttgcacaagcccttgaagagcatgtgaaggattataatatcgacgtc
atgaacctacagcgtgcaaaacgtttagaaaagaaagaatttgttgaggttgaattagaa
aacggggctattctaaaaagtaaagcaattatcatttcaactggtgctcgttggcgcaat
ttgaatgttccaggtgaggaaaagtttaaaaataaaggtgtggcctattgccctcattgt
gatggtccattatttgcaggaaaagatattgcagttgtcggtggcggtaactctggtatc
gaggcagccattgacctttccggtatagttcatcatgtaacggttcttgaattcggtgca
gaactaaaagcggatgatgtattaaaaaaacgtttacttagtctttcaaatgtgactgtc
ttaacaaatgctcaaacgacagaaattacaggggacgagaaagtaaatgggctgacttat
gtagatcgtgagtcaggtaaagaaaaacagctcgaattagctggtgtgtttgtccaaatc
ggattaataccaaacactgactggttagatggcatacttgaacgcaacaagattggtgaa
attattgtcgataagcgtggtgctactacaattcctggtgtatttgctgcaggtgattgt
actgatagtgcctacaaccaaattattattgctatgggatccggtgcaactgctgcatta
ggggcgtttgattatctaattcgaaattag

DBGET integrated database retrieval system