KEGG   Lysinibacillus sp. 2017: DCE79_11845Help
Entry
DCE79_11845       CDS       T05455                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
lyz  Lysinibacillus sp. 2017
Pathway
lyz01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:lyz00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    DCE79_11845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lyz01011]
    DCE79_11845
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lyz03036]
    DCE79_11845
Enzymes [BR:lyz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     DCE79_11845
Peptidoglycan biosynthesis and degradation proteins [BR:lyz01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   DCE79_11845
Chromosome and associated proteins [BR:lyz03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    DCE79_11845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 SH3_3 SH3_4 SH3_16 SH3_2
Motif
Other DBs
NCBI-ProteinID: AWE08034
UniProt: A0A2S1H319
LinkDB All DBs
Position
2433051..2434658
Genome map
AA seq 535 aa AA seqDB search
MNRRNLSILFIVMLFIATLLPVMQPLKKASAEGEELTVNAEILYLREGPGLSYPIIETLK
EGESLVSISKEGDWHKVRVGQKEGWVASWLVKSATQKTAAATKKTVISKVDALNLRAEPS
LSAAVLTKISSGTESEYIRQEQDWIQIQYEDYSGWVFADYVTVKEETVLKESSSEESKKP
TEKSAEKQTENDPNTFTVNVNAVNIRKKADLTSKKLGVAAKDQKFTVISRNHNWVEIEYE
KGKKGWIYSFYGTFTKQTAVKETTETKKTQGTVTIIYNGTNLRESASTASNVVTRADAGR
TYTIVETEDDWYKVALNENDTAYVANWVVTENSDPSRSQKTTTKAVETRKKGTLKGLSIV
LDAGHGGNDRGTTGVRGTDEKDINLLTVELLKSKLQSAGATVIMTRESDVFVDLRKRVAI
SHQFAADAFISIHYDALEDSSVHGFTTYYTNSYQKELAEYVHAGIAKKVSLKDRGSRFGD
YLVLRENRQNAILLELGYLSNPSEERAITTDYYREQASLGIYQGLLNYFDSKLEK
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaagaaatttgtcgattctttttatcgtcatgttattcatagctacacttctc
cctgttatgcaaccgttgaaaaaggcttcagcagagggagaagaactcactgttaatgca
gaaattctgtatttacgcgaaggacccggtttatcataccctattattgaaacattaaaa
gaaggcgaatcgctcgtttccatttcaaaagaaggcgattggcacaaagtacgtgtgggt
caaaaagaaggatgggttgcgtcttggcttgtaaagtctgctactcaaaaaaccgcggct
gcgacgaaaaaaacagtcatctcaaaagtagatgcacttaatttacgtgcagaaccttcc
ctttcagctgccgtcttaacaaaaatttcttctggtactgagagtgagtatattcgtcaa
gagcaagactggattcaaattcaatatgaagattattctggctgggtgtttgctgattat
gtcacagtgaaagaagaaaccgttttaaaagagtcttctagtgaagagtcgaaaaaacca
acagagaagtctgccgaaaaacaaacagagaatgatccaaatacgtttactgtaaatgtt
aatgccgttaacattcgaaaaaaagcagatttaacttcgaaaaaattaggcgtagccgca
aaagaccaaaaattcacggtcattagccgcaaccacaattgggttgaaattgaatatgaa
aaagggaaaaaaggttggatttatagtttttatggaacctttacaaaacaaacagctgta
aaagaaacgactgaaacgaaaaaaactcaagggactgttactattatttacaatgggaca
aacctacgtgaaagtgcctctaccgcttccaatgtcgttacacgtgcggatgccggtcga
acttacacaatcgttgaaacagaggatgattggtataaagtcgctttaaatgaaaacgac
acagcctatgtagccaattgggttgtcaccgaaaatagcgatcctagcagatcacaaaaa
actaccactaaagcagtggaaacccgaaaaaaagggacacttaaaggcttatcaatcgtc
ttagatgcaggtcacggtggtaatgatcgcggcacaactggtgtacgcggaacagacgaa
aaggatatcaatctcctaacagttgaactcttaaaatcaaaattacaatcagctggagcg
acagtcattatgacacgcgaatcggatgtatttgttgatttacgtaaacgtgtggctatc
tcacatcagtttgcagcagacgcctttattagtattcattatgatgcattagaggatagt
tctgttcacggctttacaacgtattacacaaacagctatcaaaaagaattagctgaatat
gttcatgcaggtatcgcaaaaaaagtaagcttaaaagatcgcggttcgcgttttggagat
tatttagtacttcgtgaaaatcgacaaaatgctattttactagaacttggttatttaagt
aatccatctgaagagcgtgccattacaacagactattaccgagagcaagcttctttaggt
atttatcaagggttgctaaactactttgattccaaattagaaaaataa

DBGET integrated database retrieval system