KEGG   Lysinibacillus sp. 2017: DCE79_17350Help
Entry
DCE79_17350       CDS       T05455                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lyz  Lysinibacillus sp. 2017
Brite
KEGG Orthology (KO) [BR:lyz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DCE79_17350
Enzymes [BR:lyz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DCE79_17350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored DAO FAD_binding_3 Thi4 Lycopene_cycl AlaDh_PNT_C NAD_binding_7 Glutaredoxin NAD_binding_8 FMO-like K_oxygenase Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AWE08998
UniProt: A0A2S1H5Z3
LinkDB All DBs
Position
complement(3550294..3551847)
Genome map
AA seq 517 aa AA seqDB search
MLDNQIKTQLQQYLTMLEGDLVLKVSVGDDKTSGDMLELVEEIEKMSPRITVQHAVLDRT
PSFSVNKAGEESGVVFAGLPLGHEFTSLVLALLQVSGRAPKVDAAVVKRIQAIKKTMKFE
TYVSLTCHNCPDVVQALNIMSVLNPNISNTMIEGGAFQEEIQARDIMAVPTVFLNGENFG
GGRMELEDILTKLGEVSDGSEFENVEPFDVLVVGGGPAGSAAAIYSARKGIRTGIVAERF
GGQVNDTLSIENIIGTKATEGPAFVSSLEAHVLDYNVDIMKSQRVAKIEKKDFVEVTLEN
GAVLKGKTVILSTGARYRQLGAPGEEQFKNKGVAYCPHCDGPIFKGKDVAVIGGGNSGVE
AAIDLAGIVNHVTLIQRSEELKADKVLQERVRSLKNVTVITNALTQEITGTDKVNGLTYT
DRVSGEEKHVALEGVFIQIGLLPNTEFLQGALEMNERHEIVIDKHGATSMPGVFAAGDCT
DTVYKQIVISMGSGATAALGAFDYMIRNVQNRELVEA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttagataatcaaattaaaacacaattacaacaatatttaacaatgcttgaaggggat
cttgtcctaaaagtaagcgtgggtgacgataaaacatccggggatatgttagagctagta
gaagaaattgaaaaaatgtctccacgcattaccgtgcaacacgccgttttagatcgtaca
ccaagcttcagtgtgaataaagcgggcgaagaatcgggtgtggtattcgcagggctacca
cttggccatgaattcacttcgctggtcttagcgttattacaagtttcaggtcgtgcacca
aaagtagatgcggcagttgtaaaacgtattcaagcgattaaaaaaacgatgaagttcgaa
acgtacgtaagcttaacttgtcacaactgcccagacgttgtacaagcattaaatattatg
tctgtattaaacccgaacatctcaaatacgatgatcgaaggtggcgcattccaagaagaa
attcaagcgcgcgacattatggcggtaccaacagtattcttaaacggcgaaaactttggt
ggcggtcgtatggaattagaagatattttaacaaaacttggtgaagtatcggatggttca
gagtttgaaaatgttgaaccatttgacgtattagttgtcggtggtggtccagcgggttct
gctgcagcaatttactcagcacgtaaagggattcgtacaggtatcgtggcagaacgtttt
ggtggtcaagtaaacgatacgttatcgatcgaaaacattattggtacgaaagcgactgaa
ggtccagcattcgtatcaagcttagaagcgcatgtattagattacaatgttgatatcatg
aaatcgcaacgcgtagcgaaaatcgagaaaaaagatttcgttgaagtcacattagaaaat
ggtgccgtattaaaagggaaaacagtgatcctttcaacaggagcacgttaccgtcagctt
ggtgcgccaggtgaagaacagttcaaaaataaaggcgttgcttactgcccacactgtgat
ggtccgatttttaaaggaaaagatgtagctgttattggtggaggtaactcaggtgttgaa
gcggcaatcgacctagcgggtattgtcaatcacgtaacgttaattcaacgcagcgaagag
ttaaaagctgataaagtgttacaagagcgcgttcgtagcttaaaaaatgtaacagttatt
acaaatgcactaactcaagaaattacaggtacagataaagtaaacggcttaacttacact
gaccgagtgtctggtgaagaaaagcatgttgcgctagaaggtgtcttcattcaaattggt
ttattaccaaacactgagttcctacaaggtgcattagaaatgaatgaacgccatgaaatc
gtcattgataaacatggtgcgactagcatgccaggtgtattcgcagcaggtgactgcaca
gataccgtgtacaaacaaatcgtcatttcaatgggttcaggtgcaacagcagcacttggc
gcattcgattatatgattcgtaacgttcaaaaccgtgagttagtagaagcataa

DBGET integrated database retrieval system