KEGG   Lactobacillus zymae: LZ3411_0563Help
Entry
LZ3411_0563       CDS       T05206                                 

Definition
(GenBank) Chaperonin (heat shock protein 33)
  KO
K04083  molecular chaperone Hsp33
Organism
lzy  Lactobacillus zymae
Brite
KEGG Orthology (KO) [BR:lzy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lzy03110]
    LZ3411_0563
Chaperones and folding catalysts [BR:lzy03110]
 Heat shock proteins
  HSP33
   LZ3411_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: SMS13613
UniProt: A0A1Y6JXM3
LinkDB All DBs
Position
I:638021..638908
Genome map
AA seq 295 aa AA seqDB search
MADYLVKSLVANGMFRAYAVDATDTVAEAQRRHDTWSAATAALGRTLIGTMLLSTSLLKG
DEKLTVKVNGHGPVGAIVVDGNANGTVKGYLQYPHTSLPLNAKHKIDVKKAVGTQGMLTV
TKDQGLGQPYTGQVPIISGELGEDFTYYLAKSEQIPSSVGVSVFVEPDNSVKVAGGFMIQ
VMPGATDEAIARLEKRLKEMPMVSELLLDGQKPEDILNLLFKDEEIQILQKLPVEFKCDC
SKDRFAAALASVSAEAIQEMIDEDHGAEAVCHFCGNKYEFSEDELRDILAKAQAK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcagattatttagttaaaagcttagtggccaacgggatgtttcgcgcctacgcggtc
gatgcgaccgacacggtggcggaagcccaacggcgccacgacacctggagtgccgccacg
gccgctttggggcggacgttgattgggaccatgttactgtccacgtcgctcttaaagggg
gacgagaagctgacggtcaaggtcaacgggcacggcccagtgggcgctatcgtggtcgac
gggaacgctaacggcacggtgaaggggtatttacagtacccccacaccagtttaccgttg
aacgccaagcataagatcgacgtgaagaaggcggtcggcacgcaaggcatgctgacggtc
accaaggaccaaggcctgggccaaccgtatacgggacaagtccccattatctcgggagaa
ttaggcgaagactttacctattatctggcgaagtccgaacaaatcccgagttccgtgggg
gtgtcggtcttcgtggaacccgataattcggtcaaggtggccggtggcttcatgattcag
gtcatgccaggcgccacggacgaggccatcgcccggttggaaaaacggttaaaggaaatg
ccgatggtttcggaattgctcttggacgggcagaagccggaagacatcttgaacctgctc
tttaaggatgaagagattcagatcctgcagaagttaccggttgaatttaagtgtgattgc
tcgaaggaccggtttgcggcggctttggcttccgtttcggcagaagccatccaagaaatg
atcgacgaagaccacggggctgaagcggtttgccatttctgtggcaacaagtacgaattc
tccgaggatgagcttcgggatattctcgcgaaagcgcaggctaagtaa

DBGET integrated database retrieval system