KEGG   Lactobacillus zymae: LZ3411_1617Help
Entry
LZ3411_1617       CDS       T05206                                 

Definition
(GenBank) D-alanine D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lzy  Lactobacillus zymae
Pathway
lzy00473  D-Alanine metabolism
lzy00550  Peptidoglycan biosynthesis
lzy01100  Metabolic pathways
lzy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lzy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LZ3411_1617
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LZ3411_1617
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LZ3411_1617
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lzy01011]
    LZ3411_1617
Enzymes [BR:lzy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LZ3411_1617
Peptidoglycan biosynthesis and degradation proteins [BR:lzy01011]
 Precursor biosynthesis
  Amino acid ligase
   LZ3411_1617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: SMS14667
UniProt: A0A1Y6JXK6
LinkDB All DBs
Position
I:complement(1761654..1762793)
Genome map
AA seq 379 aa AA seqDB search
MEKNKLHVGLLFGGNSSEHDVSKRSARNIYDAMDKTRYTVSLFLLTRDGFVLSDAASQRV
FNGEDEATVAAEEQAKIDSANPLAPIWNLSQAKDIDVFFPIIHGNLGEDGTIQGLFRLLK
KPYVGSDVLASATSFDKDRTKQVLTANGIRNTKYVVVTPANRDAMDYATVQAKLGTDVFI
KPANQGSSVGIHKASNEQEYLDGVEDAFRYDYKVLVEETIAGLQEVEISILGNEHPQASK
LGAIRVPEKDVFYDYNNKFVDASGVTFEVPVQLPAALAEEITTMGLQTYAALGLKGMARI
DYLVSKDNVPYVGEVNTLPGFTNISLYPQLWEASGISYTELIDRLIDLAIAEFNREDRLA
YDFVPLDDNSAASTYQLKK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaataagttacacgtcggtttattattcggtggaaattcctccgagcacgac
gtttcgaaacggtcggctcgcaacatttacgacgcaatggacaagacgcgttacacggta
agtttgttcttactgacccgtgacggctttgtgttgagcgatgcagcctcccagcgggtc
ttcaacggtgaagacgaagccacggtggcggcagaggaacaagccaagatcgattcggca
aatccattggcacccatttggaatctctcacaggcgaaggacattgatgttttcttccca
attatccacggtaatttgggcgaagacgggactatccaggggcttttccggttgttgaaa
aaaccctatgttggtagtgacgtcttagcatcagccacgtcctttgataaggatcggacc
aagcaagtcttgacggctaacggtattcggaataccaagtacgtcgttgtcacccccgct
aaccgcgatgcgatggactacgccaccgttcaggctaagctggggaccgatgtcttcatt
aagcccgccaaccaaggctcttcggtgggaatccacaaggctagcaacgaacaagaatac
ctggacggggtagaagacgcgttccggtacgattacaaggtgctggtggaagaaaccatt
gcgggcttgcaagaagtcgagatttccattttgggtaacgaacatccccaagcctcgaag
ctcggggccatccgggtaccggaaaaggacgtgttctacgactacaacaataagtttgtg
gacgccagtggcgtgacctttgaagtgcccgtgcaattaccagccgctttagccgaagaa
atcaccacgatgggcctacagacctacgcggcgttaggcttaaagggcatggcgcggatc
gattatttggtctccaaggataacgtgccgtacgtgggtgaggtcaacaccttacccggc
tttaccaacatcagcctgtaccctcaactctgggaggcttccggaattagttacacggaa
ttgattgaccggctgatcgacctggccattgcggaattcaaccgtgaagaccggttggct
tacgacttcgtgccgttagacgacaattcggccgcttcaacgtatcaattgaagaagtag

DBGET integrated database retrieval system