KEGG   Martelella sp. AD-3: AZF01_01015Help
Entry
AZF01_01015       CDS       T04332                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
maad  Martelella sp. AD-3
Pathway
maad00061  Fatty acid biosynthesis
maad00780  Biotin metabolism
maad01100  Metabolic pathways
maad01130  Biosynthesis of antibiotics
maad01212  Fatty acid metabolism
Module
maad_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AZF01_01015
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AZF01_01015
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AZF01_01015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:maad01004]
    AZF01_01015
Enzymes [BR:maad01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AZF01_01015
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AZF01_01015
Lipid biosynthesis proteins [BR:maad01004]
 Fatty acid synthase
  Component type
   AZF01_01015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AMM86547
UniProt: A0A127CNZ2
LinkDB All DBs
Position
complement(226383..227192)
Genome map
AA seq 269 aa AA seqDB search
MTGLMQGKRGLIMGVANNHSIAWGIAKAVHAEGAELAFTYQGEALGRRVHPLAAEVDSDF
VVPCDVEDIESVDAVFDAIRQRWGKLDFVVHAVGFSDKSELKGLYANTTRENFVRTMVIS
CFSFTEIAKRAAELMPDGGSMLTLTYGGSTAVVPNYNVMGVAKAGLEASMRYLAGDYGPR
GIRVNAISAGPVRTLAGSGVGDARLVYAWQQRNAPLRRSTTIEDVGGSALYLLSDLASGV
TGEIHFVDNGYNILSMPIPEMMRRGDPET
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacttatgcagggcaaacgcggcctgatcatgggcgttgccaacaaccactcg
attgcctggggcatcgccaaggcggttcacgccgaaggcgccgagctcgcattcacctat
cagggcgaggcgctcgggcgacgggttcatcccctggcggccgaagtcgactcggatttc
gtcgttccctgcgatgtcgaggatatcgagagcgtcgacgctgttttcgatgcgatcagg
cagcgctggggcaagctcgacttcgtcgtccacgccgtcggcttttccgacaagagcgag
ttgaagggactttacgccaacaccacgcgggagaatttcgtccgcaccatggtgatctcc
tgcttctccttcaccgagatcgccaagcgcgcggcagaactgatgccggacggcggctcg
atgctgacgctgacctatggcggctccacggcggtggtcccgaactacaacgtcatgggc
gtggccaaggccgggctcgaggcctcgatgcgttacctggcaggcgactacggcccgcgc
ggcattcgcgtcaacgccatttcggccgggcccgtgcgcacgctcgcgggctccggcgtc
ggcgatgcccgactcgtctatgcctggcagcagcgcaatgcgccgctccggcgctcgacc
acgatcgaagatgtcggcggctcggcgctctacctgctgtccgaccttgcctccggcgtc
acaggcgagatccatttcgtcgacaacggctacaacattctctccatgccgatcccggaa
atgatgcgcaggggcgacccggaaacctga

DBGET integrated database retrieval system