KEGG   Martelella sp. AD-3: AZF01_01330Help
Entry
AZF01_01330       CDS       T04332                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
maad  Martelella sp. AD-3
Brite
KEGG Orthology (KO) [BR:maad00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AZF01_01330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:maad03400]
    AZF01_01330
Enzymes [BR:maad01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AZF01_01330
DNA repair and recombination proteins [BR:maad03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AZF01_01330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AMM83169
UniProt: A0A127CE96
LinkDB All DBs
Position
284727..287192
Genome map
AA seq 821 aa AA seqDB search
MAEIDRLAEYVTRRDFSRTGEPGRGTRRKSRKDKLSFVVQKHDASRLHYDFRLEWSGTLL
SWAVTRGPSDDPREKRLAVRTEDHPLDYAGFEGTIPKDQYGGGTVMVWDRGTWEPVGDPE
QGLSEGKLKFCLKGERMNGGWALVRMRGRKGERRENWLLIKERDGMAGDEADHLTGTFET
SVKTGRLLDAIEQDGKPKRTGSKSGSSSGKMPKFRKPELATLYDAVPEGEGWIHETKFDG
YRCIAAVGKGGPRFFTRSGQDWTDKYQALADAFDALEGESLLLDGEIMAADVPKNGSAFS
ALQAALHDGAPLLYYVFDILEHNGRSLTDCPLLERKAVLEEALAPLDLEEGKVRVSAWVE
GNGGDILEKICKAGGEGIVSKKADAPYRHGRTKSWRKVKCGKRQEFVIGGYSPSSKRGRA
FASLLLGQYADDGRLCYRGRAGTGFSADELDRLGGKLKSLSRKTAPFEDVPGAIARDAAW
VTPKLVAEIEFAELTAEGHVRHGAYLGLRGDKEAEEVTPENETRSDATVKGITITHPDRE
LFAKAGVSKLDIARHYGLVGERMVEICGERPVSLLRCPAGIEEECFFQKHAGKGFPDELT
RIAIAEKDGETGEYLYASGAEGYVAAAQMGTIEFHGWAARADRLERPDRMVFDLDPDEKL
GFAETKQAAFDLKSLLSDIGLEAYAMVTGGKGVHLVVPLRRTVGWDTLKSFAKTLAHLMA
EREPDRFTATMSKEKRKGRIFIDWLRNERGATAILPYSVRARPGAPVATPVTWDELKELK
SAAAFGLKDMAERLGQEEPALAVKPQTLAKAVIDKLKRRLG
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatcgacagacttgcagaatacgtgacgcgccgcgatttttcgcgaaccggg
gagcctgggcgcggaacccgcaggaaaagccgcaaggacaagctttccttcgtggtgcag
aaacacgatgcctcccgacttcactatgactttcggctggaatggagcggcacgctcttg
agctgggcggtgacgcgcggaccgagcgacgatccgcgggaaaagcggctggcggtgcgc
accgaggaccatccgctcgactatgccggcttcgaaggcacgatcccgaaggaccagtat
ggcggcggcaccgtcatggtctgggaccgcggcacatgggaaccggtcggggaccccgaa
cagggactttccgagggcaaactgaaattctgccttaagggcgaacgcatgaacggcggc
tgggcgctggtgcgcatgcgcggcaggaagggcgaaaggcgcgagaactggctgctgatc
aaggagcgcgacggcatggccggcgacgaggccgatcatctgacgggcacctttgagacc
agcgtcaagaccgggcgcttgctcgacgcgatcgaacaggatgggaagccgaaaaggacc
gggtcgaaatcaggatcttccagcgggaaaatgccgaaattcaggaagcccgaactggcc
acgctctacgacgcggtgccggaaggcgagggctggatccacgaaaccaaatttgacggc
tatcgctgcatagccgccgtgggcaaaggcggaccgcgcttcttcacccgctcgggccag
gactggaccgacaaataccaggcgcttgccgatgcctttgacgcgctggaaggcgagagc
ctgttgctcgacggcgagatcatggcggccgatgttcccaaaaacggctcggccttttcc
gcgttgcaggcggcgcttcatgacggcgcgccgctcctctattatgtgttcgacatcctc
gagcacaatggcaggtcgctgaccgactgcccccttcttgagcgcaaggcggtgcttgag
gaggcgcttgcgccgcttgacctcgaagagggcaaggtgcgggtttcggcctgggtcgag
ggcaatggcggcgacattctcgagaagatctgcaaggccggcggcgagggcatcgtctcc
aagaaggccgatgcgccctatcgccacggccgcacaaaaagctggcgcaaggtcaagtgc
ggcaagcggcaggagttcgtcatcggcggttattcgccctcttcgaaaaggggccgcgcc
ttcgcctcgctgttgctcggacaatatgcggatgacgggcgtctgtgctatcgtggccgc
gccgggacagggttttcggcggatgaactcgaccggctgggcggcaagttgaagagcctt
tcccgcaagaccgctcctttcgaagatgtgccgggggcgatcgcgcgggatgctgcctgg
gttacgccgaaacttgtggcggaaatcgagttcgcggagctgaccgccgaagggcatgtg
cgccacggcgcctatctcggcctgcgcggcgacaaggaggcggaagaggtgacaccggaa
aacgagacgcgcagcgacgccacggtcaagggcatcaccataacccatccggaccgcgaa
ctctttgcgaaggccggggtgagcaaactcgatatcgcccggcattatggtctcgtcggc
gaacgcatggtcgaaatctgcggcgaacgcccggtttcgctgctgcgctgccccgccggg
atcgaggaggagtgctttttccagaagcacgctggcaagggctttcccgatgagctgacc
cgcatcgccattgcggaaaaggacggagagacgggagaatatctctatgcttcgggcgcg
gaaggctatgtcgccgccgcccagatgggcacgatcgagtttcacggctgggcggcgcgc
gccgaccggctggaacgacctgaccggatggtcttcgatctcgatccagacgagaagctc
ggctttgccgaaacgaagcaggcggctttcgacctgaagtccctgctgtccgatatcgga
cttgaggcctatgcgatggtgaccggcggcaagggcgttcaccttgtcgtgccgcttcgg
cgcaccgttggctgggatacgctcaaatccttcgccaaaacgctcgcccatctgatggcc
gagcgcgaaccggaccgcttcacggccaccatgtcgaaggaaaagcgaaaggggcggatc
ttcatcgactggctgcgcaatgaacgcggcgcgaccgcgatcctgccctattccgtccgc
gcccggcccggcgccccggtggccacccccgtcacctgggacgaactgaaggagctgaag
tcggccgccgcctttggcttgaaggacatggccgaacgcctggggcaggaagagccggcg
ctggccgtcaagccgcagacgctcgccaaggcggtgatcgacaagctcaagaggcggctt
ggctga

DBGET integrated database retrieval system