KEGG   Martelella sp. AD-3: AZF01_03970Help
Entry
AZF01_03970       CDS       T04332                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
maad  Martelella sp. AD-3
Pathway
maad00240  Pyrimidine metabolism
maad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AZF01_03970
Enzymes [BR:maad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AZF01_03970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: AMM86621
UniProt: A0A127CP87
LinkDB All DBs
Position
877933..878514
Genome map
AA seq 193 aa AA seqDB search
MAKLHYYYATMNAGKSTLLLQAAYNYRERGMHAVILLAEFDDRAGKGVVSSRIGLKADAV
TFGPETDLFELAGRLNGEKAIDCLFVDESHFATAGHVWQLARIVDELGLPVMAYGLRSDF
RGELFPASRELFVLADEIREVRTICHCGRKATMVVRLDGEGNVALAGPQIEVGGNERYVS
YCRKHWKEKTGLR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcttcactattactacgcgacgatgaacgcgggaaaatcgacgctgcttctg
caggcggcctataattaccgcgagcggggcatgcatgccgtgatcctgctggcggaattc
gatgatcgggccggcaagggcgtcgtctcgtcccgcatcgggctcaaggccgatgccgtg
acattcgggcccgagaccgatctcttcgaactggccgggcggctgaacggcgagaaggcc
atcgattgcctgtttgtcgatgagtcgcatttcgccaccgccggtcacgtgtggcagctt
gcgcggattgtggacgaactcggccttccggtgatggcctacggcctcaggtccgatttt
cgcggcgagctgttcccggcctcgcgggagttgttcgttttggcagacgagatccgcgaa
gtgcggacgatctgccattgcggccgcaaggccaccatggtggtccggcttgacggagag
ggcaatgtggcgcttgccggcccgcagatcgaagtggggggcaatgagcgctacgtttcc
tattgccgcaagcactggaaggagaagacggggttgagataa

DBGET integrated database retrieval system