KEGG   Martelella sp. AD-3: AZF01_05790Help
Entry
AZF01_05790       CDS       T04332                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
maad  Martelella sp. AD-3
Pathway
maad00473  D-Alanine metabolism
maad00550  Peptidoglycan biosynthesis
maad01100  Metabolic pathways
maad01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AZF01_05790
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AZF01_05790
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AZF01_05790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:maad01011]
    AZF01_05790
Enzymes [BR:maad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AZF01_05790
Peptidoglycan biosynthesis and degradation proteins [BR:maad01011]
 Precursor biosynthesis
  Amino acid ligase
   AZF01_05790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AMM83933
UniProt: A0A127CGW3
LinkDB All DBs
Position
1253636..1254559
Genome map
AA seq 307 aa AA seqDB search
MSSGHVAVLMGGFSSERQVSLASGKSCADALEAEGFRVSRIDVTRDVATVLSEMKPDVAF
NALHGPFGEDGKVQGILEYLEIPYTHSGVLASALAMDKAQAKRVASACGVPVAESLLLQR
GEIGNTHPMAPPYVLKPINEGSSFGVLIVDEDQANPPQSISSNEWTFGEKIMVERFIKGR
EFTCGVMDGTALCVTEIVPVGQKFYDFDAKYRPGGSKHILPAEIKPNIYQKIQSLAVQAH
QAIGCRGVSRSDFRFDETLGEDGIIWLEVNTQPGMTETSLVPEMAADAGYDFGAFLRWMV
EDASCLR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagttccggacatgtggctgtattaatgggcgggttttcctccgagcgtcaggtcagc
ctggcgtcgggaaagtcctgcgccgatgcgctggaagccgaaggcttccgcgtcagccgg
atcgatgtgacccgcgacgttgccaccgtgctttccgagatgaagcccgatgtcgccttc
aatgcgctgcacggacccttcggcgaggacggaaaggtccagggcatcctcgaatatctt
gagatcccctatacccattccggcgtgctggcatcggcgctcgccatggacaaggcccag
gccaagcgcgtggcgtccgcctgcggcgttccggtcgccgaaagcctccttcttcagcgc
ggcgagatcggcaatacccatccgatggcgccgccctatgtgctgaagccgatcaacgag
ggctcgtccttcggcgtcctgatcgtcgacgaggaccaggcaaacccgccgcagtcgatc
tcgtccaacgagtggaccttcggcgagaagatcatggtcgagcgcttcatcaagggccgc
gaattcacctgcggcgtgatggacggcacggcgctgtgcgtgaccgaaatcgttcccgtc
ggccagaaattctacgatttcgacgcgaaatatcggcccggcggatcgaaacacattctg
cccgcggaaattaaaccgaatatttaccaaaagattcaatcattggccgttcaggcgcat
caggcaatcgggtgccgcggcgtttcccgttcggacttccgtttcgacgagacgctgggt
gaggatggcatcatctggctggaggtgaacacccagcccgggatgaccgaaacttcgctg
gtacccgagatggctgccgatgccggctatgattttggtgcatttctccggtggatggtg
gaggacgcttcgtgtttgcgatga

DBGET integrated database retrieval system