KEGG   Martelella sp. AD-3: AZF01_07245Help
Entry
AZF01_07245       CDS       T04332                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
maad  Martelella sp. AD-3
Pathway
maad00500  Starch and sucrose metabolism
maad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZF01_07245
Enzymes [BR:maad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AZF01_07245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AMM86696
UniProt: A0A127CPD1
LinkDB All DBs
Position
1572316..1574718
Genome map
AA seq 800 aa AA seqDB search
MSDMIDFAAGAPGIGSRWTSSAKSGVGTALSTASPVWFTLSHGILNEIYYPRVDSACTRD
FGFLVTGPDGYFSEEKRDCEQETTPLEDGVPAFSIVNTALDGAYRIRKQIISDPARAVVL
QRISFSALKGRTRDYRVTALLAPHLVNAGASNSAWIGEFEGAPALFASGRSRYLALVSSA
PWRAMSAGFVGTSDGWQQLSRHGRLVDQYQRADDGNVALAGEIDFSGGDGSVVLALGFGQ
TEHEAAAAATRSLKDGFDHALDKFITGWRKWQDGLVPLDRKAEDGINAYRVSTAVLATHR
ASDRPGAAVASLSIPWGYSKGDDDLGGYHLVWPRDLVETAGGFLAAGDAKEALAILDYLR
ELQQPSGRWAQNFWLDGKPYWHGVQMDECAFPILLTDMLRRQGHLNSKTIRRFLPMIKSA
AGYILANGPSTGEDRWEEDGGYSPFTLAVEITALLAAADILEAEGETKAAHHLRETADCW
NEQIEKWTFEGDPDLCRALDIAGYYVRIAAPGATDAAGPAGETPIRNQTPDRSIMASDAV
ISPDALALVRFGLRAADDPHIVDTVKAIDHTLRRELPQGPLWYRYTGDGYGEHEDGRAFD
GIGQGRPWPLLAGERAHYELAAGRTDAAKALLQTLEKSANAGGLLPEQSWDGPDMPDREL
YFGRPSGSAMPLVWAHSEHIKLLRSLADGAVFDMPPQGRSRYIERQTTSKIRIWRFDNRL
ATIPVGKNLRIELADAATIHWSADGWSTVKDIKTRPSGLGTHFADLPLKGVEPGHAVVFT
FFWPESGEWENVDFTVRVGE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatgatcgattttgccgcaggcgcgccgggtatcggttccaggtggacgtcg
agcgccaagagcggggttggcaccgcgctttcgacggcttcgccggtctggtttacgctg
agccacggcattctcaacgagatatattatccgcgcgtcgacagcgcctgcacccgcgat
ttcggtttcctcgtgaccggcccggatggctatttttccgaggaaaagcgcgattgcgag
caggagacaacgccgctcgaggatggcgttccggccttttcgatcgtcaacaccgccctt
gacggcgcctaccggatcagaaagcagatcatcagcgatccggcgcgggctgtcgtcctc
cagcgcatttcgttcagcgcgctcaagggcaggacccgcgattaccgggtgaccgcgctt
ctagcgccgcatctggtcaatgccggtgcgtcgaactccgcctggatcggcgaattcgag
ggcgcgccggcgctgtttgccagcggccgctcccgctatctggcgctggtatcaagcgcg
ccgtggcgggcaatgtccgccggtttcgtcggaacgtcggatggctggcagcaattgtcc
cggcatgggcggctcgtcgaccagtaccagcgcgccgatgacggcaatgtggcgctggcc
ggcgagatcgatttttccggcggcgatggttccgtggtactggcgctcggtttcggccag
accgaacacgaagcggcggccgcagccacgcggagcctgaaggacggcttcgaccacgct
ctggataaattcataaccggctggcggaaatggcaggacggtctggtcccgctcgatcgc
aaggcggaagacgggatcaacgcctatcgcgtctcgacggcggtgcttgcgacccaccgg
gcctcggaccggcccggcgccgcggttgccagcctgtcgatcccctggggctattcgaaa
ggcgatgacgatcttggcggctaccatcttgtgtggccgcgcgacctggtcgagacggcc
ggcggctttctggccgcaggcgacgcgaaagaggcgctggcgatcctcgattatctgcgc
gagttgcagcagccctccggccgctgggcgcagaacttctggctcgacggcaagccctac
tggcatggcgtccagatggacgagtgcgcctttccgatcctgcttaccgacatgttgcgg
cgtcagggccatctgaacagcaagacgatccgccgctttctgccgatgatcaagagcgcc
gccggctatatcctcgccaatggtccgtccaccggagaagaccgctgggaagaggacggc
ggatacagcccgttcacgctcgcggtcgaaatcacggccctgctggccgctgccgatatt
ctggaagccgagggcgaaacgaaagcggcccatcatctgcgcgagacggccgattgctgg
aacgagcagatcgagaaatggaccttcgagggcgatccggacctctgccgggcactggat
atcgcgggctattacgtccgcattgccgcgcccggggcaacggatgccgccggaccggct
ggcgaaacgccgatccgcaaccagacgcccgaccgttcgatcatggcgagcgatgccgtg
atcagtccggacgcgctggcgctggtgcgcttcgggctgcgcgcggcggacgatccgcat
atcgtcgataccgtcaaggcgatcgaccacacgctgcggagggaactgccgcaaggcccg
ctctggtaccgctacaccggcgacggctatggcgagcatgaagacggtcgggcattcgac
ggtatcggtcaggggcggccctggcccttgctggccggcgagcgcgcccactacgagctt
gccgccggccgaaccgatgcggccaaggccctgcttcaaacgcttgaaaaatccgccaat
gccggcgggctgctcccggagcaaagctgggatggccccgacatgccggaccgcgagctc
tatttcgggcggccttcgggcagcgcgatgccgctggtctgggcgcattcggagcatatc
aaactgttgcgctcgctcgccgatggcgccgtgttcgacatgccgccgcagggccggagc
cggtatatcgagaggcagacaacgtcaaaaatacggatctggcggttcgacaacaggctg
gccacgatcccggtcggcaagaatctcaggatcgaactggcggatgcggccaccattcac
tggagcgccgatggctggtcgaccgtcaaggacatcaagacgaggccatcggggctcggg
acccatttcgcggatctgccattgaagggcgtggaacccggacatgccgtggtcttcact
ttcttctggccggaaagcggagagtgggagaatgtagatttcaccgttcgcgtcggcgag
tag

DBGET integrated database retrieval system