KEGG   Martelella sp. AD-3: AZF01_10280Help
Entry
AZF01_10280       CDS       T04332                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
maad  Martelella sp. AD-3
Pathway
maad00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AZF01_10280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:maad02000]
    AZF01_10280
Enzymes [BR:maad01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AZF01_10280
Transporters [BR:maad02000]
 Other Transporters
  Pores ion channels [TC:1]
   AZF01_10280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AMM84691
UniProt: A0A127CIN7
LinkDB All DBs
Position
2215256..2215873
Genome map
AA seq 205 aa AA seqDB search
MSRITLYTNPLSRGRIARWMLEETGAEYETRILTYNGTMKEPEYLAINAMGKVPTIVHDG
KVVTECAAICAYLADAFPEAGLAPPPADRASYYRWLFFAAGPLEAAVVNRTFGFEVPPER
ERAVGYGNFEHVMDALDQWLSENPFIAGDSFTAADVYVGAQINWGMQFGTVDKRASFAAY
AERISTRPAFIRATGLDDAAAAEMA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaattaccttgtataccaacccgctttcgcgcggtcggatcgcacgctggatg
ctggaagagaccggagcagaatacgaaacccgcattctgacctataatggcacgatgaag
gaaccggaatatcttgcgatcaacgcgatgggaaaggtgccgacgattgttcatgatggc
aaggtggtgacggaatgcgccgcgatctgcgcctatcttgccgatgcctttcccgaggca
gggctcgcgccgccgcccgccgaccgcgcctcctactaccgctggctgttcttcgcggca
ggtccgctcgaggctgcggtggtcaaccggaccttcgggttcgaggtgccgcccgagcgc
gaacgcgccgtcggctacggcaatttcgagcacgtgatggacgcgctcgaccaatggctt
tcggaaaacccgtttatcgccggtgacagcttcaccgcagccgatgtctatgtcggcgcg
cagatcaattgggggatgcaattcggcacggtcgacaaacgggcgtctttcgcggcctat
gccgagcgtatatccacccgcccggccttcatccgcgccaccgggctggatgacgcggcg
gcggcggagatggcgtag

DBGET integrated database retrieval system