KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0279cHelp
Entry
MAB_0279c         CDS       T00657                                 

Definition
(RefSeq) Probable DNA ligase LigC
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 5962822
NCBI-ProteinID: YP_001701033
LinkDB All DBs
Position
complement(278241..279272)
Genome map
AA seq 343 aa AA seqDB search
MLAKPVAKIPDGASYEPKWDGFRSIVFRDGDEVELGSRNEKPLTRYFPELVAAVLAELPP
RCVVDGEIVIATEAGLDFEALQQRIHPADSRVRLLAEQTPSSFIAFDLLALGDEDYTGRP
FSERRAALTEALSSAGTSIHLTPATTDQALAQRWFEEFEGAGTDGLIAKPLAIAYQPDKR
VMFKIKPERTADCVVAGYRVHKSGDDAIGSLLLGLYQEDGILASVGVIGAFPMAERKRLF
QELQPLIIPLENHPWNWAAHEAGERTPQKNAGSRWNAGKDLSFVPLRPERVVEVRYDHME
GVRFRHTAQFNRWRPDRDPRSCTYEQLEQPITFSLNDIVPGLV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccaaacctgtcgcaaaaatccctgacggcgcctcctacgaacccaagtgggat
ggattcaggtcgatcgtctttcgcgacggcgacgaggtggagctgggtagccgcaatgag
aagccactgacccggtacttccccgagttggtagcggcggtgctcgccgaactaccgcca
cggtgtgtcgtcgacggtgagatcgtgatcgccaccgaggcgggtctggatttcgaggcg
ctgcaacaacggatccacccggcggattcgcgggtacggctgttggccgagcagacaccc
tcctccttcatcgcattcgacctgctcgccttgggcgacgaggactacaccgggcggccc
ttcagcgagcgccgtgccgcgctgacggaagcgctctcgagtgccgggacctcgatacat
ctgacccccgccaccacagatcaggcactggcgcagcgctggttcgaggaattcgagggc
gccggtaccgacggtctcatcgccaaaccgttggccatcgcctaccaacccgacaaacga
gtgatgttcaagatcaagccggagcgaaccgccgattgcgtggtcgcgggctaccgagtg
cacaaatcgggtgacgatgccatcggctcgctgctgctgggcctgtaccaggaggacggc
atattggcgtcggtcggtgtgatcggcgcgttccccatggccgaacgcaagcgcctattc
caagaactgcaaccgttgatcatcccgctcgaaaatcacccgtggaactgggccgcacac
gaagccggcgagcgcactccgcagaagaacgccggctcccgctggaacgcgggcaaggat
ctttcgtttgtcccgctgcgtcccgagcgagtggtggaggttcgctacgaccacatggag
ggtgtgcggttccgtcataccgcgcagttcaaccgctggcgcccggatcgcgacccgcga
tcctgcacctacgagcagctagaacaaccaattacattcagcctcaacgatatcgttcca
ggtctggtgtga

DBGET integrated database retrieval system