KEGG   Mycobacteroides abscessus ATCC 19977: MAB_1033Help
Entry
MAB_1033          CDS       T00657                                 

Definition
(RefSeq) Putative ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mab00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MAB_1033
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mab03400]
    MAB_1033
Enzymes [BR:mab01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MAB_1033
DNA repair and recombination proteins [BR:mab03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MAB_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-GeneID: 5963561
NCBI-ProteinID: YP_001701777
LinkDB All DBs
Position
1042671..1044923
Genome map
AA seq 750 aa AA seqDB search
MLYPATDTSPATTKADVFGYYTAIAPFMLPHIAGRPVTRKRWPNGIDQPSFFEKDLASSA
PDWLPRRRIEHKSRYVSYPLIDTSVALAWIAQQAALEVHVPQWRFAGENPGPATRLVFDL
DPGEGVGMAQLAEVARAIRDVLADIGLTTFPVTSGSKGLHLYVPLAQPASSSGAVAVAKK
VAVQLEQVMPDLVTATMTRQLRAGKVFVDWSQNSGSKTTVAPYSLRGRAVPTVAAPRTWE
ELDDPGLRQLRYDEVLTRAQRDGDLLAGLDDVEIAEDRLSTYRSMRDPTRTPEPVPAVKP
EAGQDNSFVIQEHHATALHYDFRLERDGVLVSWAVPKNLPLEPSVNHLAVHTEDHPLEYG
SFEGTIPKGEYGAGEVTIWDSGTYDTEKFIDPRDDSGADGGQKGEVIVTLHGKRITGRYA
LIRTNGKQWLVHRMKDQRPAGSMPVGLAPMLPTTGSVAGLTAEEWAFEGKWDGYRLILEC
DRGQLRALARSGRDVTAEFPALQRLAHELSDHRVVLDGEVVVPDRKGLPSFALLQNRTPG
ADIRFWAFDLLYLDGKSLLRTKYRDRRRLLEVLVTGTESMTVPQQLSGDGAAALAYSQDQ
GWEGVVAKRLDSTYVPGRTQSWIKAKNWSSQEVVIGGWRKGQGGRSSGIGSLLMGIPVEG
GLRYAGRVGTGFTERELSSLKERLEPLHRAESPFDAPLSTVEAKDVQFVEPVLVAEVRYG
DRTPGGILKHSSWRGLRTDKSVRDVELDLG
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtacccggccacggataccagcccggccaccaccaaagcggatgtctttggctac
tacaccgcgatcgcccccttcatgttgccgcatatcgcgggccggccggtcacccgcaag
cggtggcccaacggcattgaccagccgtcgttcttcgagaaggacctggcttcttcggcg
cccgactggctgccgaggcgccgcatcgagcacaagtcccgctacgtcagctacccgctg
atcgacacctcggtcgccttggcgtggatcgcgcagcaggcggcgctcgaggtgcacgtg
ccacagtggcgattcgccggtgaaaatccaggtccggcaacccggttggtattcgaccta
gacccgggcgagggagtcggcatggcccaactggcggaagtggccagggccatccgggat
gtgctggccgatatcggcctgacgacctttccggtgaccagtggaagcaagggcctgcac
ttgtacgtgccgctggcgcaaccagccagctcgtccggtgcggtcgccgtggcgaagaag
gttgccgtccagttggagcaggtgatgcccgacctggtgacggcgacgatgacccgacag
ctacgcgcgggcaaggtcttcgtggattggagccagaacagcggttccaagacgacggtg
gcgccctactcattgcgtggccgggcggtgccgaccgtcgccgcgccgcgcacgtgggaa
gaactggacgaccccggcctgcgtcagctgcgatacgacgaagtactgacgcgggcccag
cgtgacggcgacctgctggccgggctcgacgatgttgagatcgccgaggacaggctgtcc
acctatcgcagcatgcgcgatcccacacgcacgcctgaaccggtaccggcagtcaaaccc
gaagctgggcaagataattcatttgtcatccaggagcatcacgccaccgcgctgcactac
gacttccggctggagcgcgacggcgtgctggtgtcgtgggcggtgcccaagaacctgccc
ctggaaccgtcggtcaatcatctcgcggtgcacaccgaggatcatccgctggagtacggc
tccttcgaaggcaccatcccgaagggggagtatggggcgggcgaggtgacgatctgggac
tcgggcacttacgacaccgagaagttcatcgacccgcgcgacgattcaggagccgacggc
gggcaaaaaggtgaggtcatcgtgaccctccacggcaagcgaatcaccgggcggtacgcg
ctgattcgaaccaacggcaagcaatggctggtgcaccggatgaaggatcagcggcccgcc
ggttcgatgcccgtcggtctcgcgccgatgttgccgaccaccgggtcggtggcgggtctg
accgccgaagaatgggcgtttgaaggcaaatgggacggctatcggctgatcctggaatgc
gatcgcggacagctcagagcattggcgcgcagcgggcgcgacgtcacggccgaattcccg
gcgttgcaacggcttgcgcatgaactgtccgatcaccgggtggtactcgacggcgaggtg
gtggtgccggatcgtaagggcctgcccagctttgcgctgctgcagaataggacaccaggc
gccgacatcaggttctgggccttcgatctgctgtatctggacggaaaatcgttgttgcgt
accaagtatcgggaccgacgtcgactgcttgaggtgctggttaccggcaccgaatcgatg
acagtcccgcagcagttgagcggcgacggcgccgcggcccttgcgtactcgcaggatcaa
ggctgggagggggtggtggccaagaggctggattccacctacgttcccggccgaacacag
tcttggatcaaggcaaagaactggagtagtcaagaggtcgtcatcggcggctggcgcaag
gggcagggcggccgcagcagcggaatagggtccttgctcatgggaatacccgtcgagggt
ggtctgcgctatgcgggccgggtcggtaccggattcaccgagagggaactgtcatcgctg
aaggagcgtctagagcccctgcaccgtgccgaatcgcctttcgatgcgccgctgtccacc
gtcgaggccaaggatgtgcagttcgtcgagccggtgttggtggccgaagtccgatacggt
gaccgcaccccgggcggaattctgaagcactcaagttggcgcggactgcgcaccgacaag
tcagttcgcgacgtcgagctcgatctcggatag

DBGET integrated database retrieval system