KEGG   Mycobacteroides abscessus ATCC 19977: MAB_2530cHelp
Entry
MAB_2530c         CDS       T00657                                 

Definition
(RefSeq) Catalase CatB
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00380  Tryptophan metabolism
mab00630  Glyoxylate and dicarboxylate metabolism
mab01110  Biosynthesis of secondary metabolites
mab01130  Biosynthesis of antibiotics
mab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MAB_2530c
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MAB_2530c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MAB_2530c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-GeneID: 5965040
NCBI-ProteinID: YP_001703265
UniProt: A0A2C9Y7X3
LinkDB All DBs
Position
complement(2577471..2579579)
Genome map
AA seq 702 aa AA seqDB search
MDRTSNPKQEQLDTSRVDRASGYLTTQQGVRVDHTDDALTAGVRGPTLLEDFHAREIVTH
FDHERIPERVVHARGAGAYGYFEPYDAWLSDFTAAKFLTTPGLRTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTQQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPDNEIPQAASA
HDTLWDFVAEQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNDAGEGVFVKFHWKP
LLGVHSLLWDECQQIAGKDPDFNRRDLWDAIESGQFPEWELGVQLVPESDEFKFPFDLLD
STKIIPEEQVPVQPVGRMVLDRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPIAEVHNNQRDGFAQHDIPQGKSSYFKNTLGGGCPALAHE
DVFRHYTQRVDGHKIRQRAESFKDFYSQPRMFWNSMSAVEAQHIVSAFSFELGKVSAEAG
IRERVVAQLNLVEHDLASQVALQLGLPAPAPQSADEALPPSPALSQLSTTRDSIATRRIA
VLAADGVDIHGVELLRAALEESDAIVEILAPTGGGTLTGESGGELRVDRAMTTMASVLYD
AVVVPSGAESAWRLARNGFAVHFVSEAYKHLKPVAAYGSGLDLLRAASVVETLATTTEIV
VDDGVVTTTAEANALPAEFVAAFVTAISRHRAWERETEMVPA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtggaccgcacgtcgaatcccaaacaagagcaactcgacacgtcccgggtggaccgagcc
tctggttatctcactacccagcaaggcgttcgcgtcgaccacaccgatgacgcgctcacc
gccggtgtcaggggccccacgctgctggaggattttcacgcccgcgagatagtcacgcat
tttgaccacgagcgcattccagagcgtgtggttcatgcgcgcggcgcgggcgcatacggc
tacttcgagccgtacgacgcgtggctatcggacttcacagccgcgaaatttctcaccaca
cccggcctgcgcacaccggtgttcgttcgtttctctaccgttgcggggtcccgcggctcg
gcagacaccgtgcgcgacgtacgcggatttgccacgaaattctatacacagcaaggcaat
tacgatctggtcggcaacaatttcccggtattctttatccaggacggcatcaaatttccg
gacttcgtgcacgcggtgaagcctgagcccgacaacgagatcccgcaggccgcctcggcg
catgacaccttgtgggacttcgttgccgagcagcccgagacgctacacgcgatcatgtgg
ctcatgtccgatagggctctgccccgcagctaccgcatgatgcaagggttcggcgtacac
accttccggttggtcaacgacgccggcgagggcgtttttgtgaagttccactggaagccg
ctgctgggcgtgcactcactgctgtgggacgaatgtcagcagatcgccggcaaggacccc
gatttcaaccggcgcgatctctgggacgcgattgagtccggccagtttccggaatgggaa
ctcggagtgcagctggtgccggaatccgacgagttcaaattccccttcgaccttcttgat
tcaacgaaaatcattccggaagaacaggttccggtgcagccggtcggacgcatggtgctg
gatcggaaccccgacaacttctttgccgagacagaacaggtcgcattccacacggccaac
gtggtgccgggaatcgacttcaccaacgacccgctgcttcagtttcgtaacttctcctac
ctggatacacaactgatccgcctgggcggtccgaacttcgcacaactgcccatcaacaga
ccgatcgccgaggtacacaacaaccagcgagacggcttcgcgcagcatgacatcccacaa
ggcaagtccagctatttcaagaacaccctcggcggcggctgtccggccctggcacatgaa
gatgtcttccgccactacacccaacgagtggacggacataagatccgccagcgcgccgag
agcttcaaggatttctacagccagccgcggatgttctggaacagtatgtccgccgtcgag
gcgcagcacatcgtttcggcattctcgttcgaactgggcaaggtgagtgccgaggccggg
attcgcgaacgtgttgtcgctcaactcaacctggtggaacacgatcttgcttctcaagtc
gccttgcagctgggcttacccgccccagcgccgcaatcggccgacgaggctcttccaccg
tccccggcgctgtcccagctttccaccacccgagacagcatcgccacccgacggatcgcg
gtgctcgcggccgacggcgtcgatattcacggcgtggagttgcttcgtgcggcgctggaa
gagagcgacgcgattgtcgagatactcgcaccgactggcggcggaacgctcaccggcgaa
tccggcggcgaactccgcgtcgaccgcgcgatgaccacgatggcctcggtgttatacgac
gccgtagtcgtaccctccggagccgaatccgcctggcggctggcgcgcaacggcttcgcc
gtgcatttcgtttccgaggcctacaaacatctcaagcccgtcgcggcctacggttccgga
ctcgatctgctccgggcagcctctgtggtcgaaacacttgccaccaccacggagattgtg
gttgacgacggcgtggtgacgaccaccgcggaggccaatgcattgccggccgaattcgtg
gccgcgtttgtcacagcgatcagccggcatcgcgcctgggaacgcgagaccgagatggtg
cccgcatag

DBGET integrated database retrieval system