KEGG   Mycobacteroides abscessus ATCC 19977: MAB_3286cHelp
Entry
MAB_3286c         CDS       T00657                                 

Definition
(RefSeq) Probable D-alanine--D-alanine ligase DdlA
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00473  D-Alanine metabolism
mab00550  Peptidoglycan biosynthesis
mab01100  Metabolic pathways
mab01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MAB_3286c
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MAB_3286c
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MAB_3286c
Enzymes [BR:mab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MAB_3286c
Peptidoglycan biosynthesis and degradation proteins [BR:mab01011]
 Precursor biosynthesis
  Amino acid ligase
   MAB_3286c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-GeneID: 5965786
NCBI-ProteinID: YP_001704016
UniProt: A0A2C9Y0N6
LinkDB All DBs
Position
complement(3324130..3325275)
Genome map
AA seq 381 aa AA seqDB search
MNDSVGRSRADQQRIKVALVFGGRSSEHAISCVSAGSILRNLDQAVYEVVAVGVTPEGGW
VLTDGDPAQLAISDRTLPQVTDASGTELLLATDPRRAGQLVNVDSSAAGQVLASVDVVFP
VLHGPYGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLAAEGLPIGKYAVIRPR
DTTLTLDQREDLGLPVFVKPARAGSSFGVSRVTAWEELPAAIAHARQYDPKVIVEAAIVG
RELECGVLEFPDGDTRASVLGEIRVEGVNRDQTAAGAFYDFETKYLDDTAELDVPAKVDD
DVSDQIRELAVAAFRAIDCQGLARVDFFLAEDGPLINEINTMPGFTTISMYPRMWDATGV
DYPTLLDAMVRTALARGTGLR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgactcggtgggccgctcgcgcgcagaccaacagcggatcaaggtcgcgctcgtc
tttggcgggcgcagcagtgagcacgcgatctcgtgcgtgtccgccggcagcattctgcgc
aatctggaccaggccgtctatgaggtagtcgccgtgggggttactcccgagggcggttgg
gtgctgaccgatggcgaccccgcgcagctggcgatcagcgacaggacgctgcctcaggtc
accgacgcatccggcaccgagttgttgctcgccaccgatccgcggcgagcggggcagctg
gtgaacgtggactcgagcgccgccgggcaggtgctggcctcggtcgatgtggtgttcccg
gtgctgcacggtccctatggcgaggatggcaccattcagggactgttggagctggccggg
gtgccctacgtgggtgccggtgtgctcgcgagtgcggccggtatggacaaggagttcacc
aagaagctgctggcggccgaggggctcccgattggcaagtacgccgtgatccgcccgcgc
gacaccacgctgacgctggatcagcgcgaggacctggggctgccggtattcgtcaagccc
gctcgggcgggatcgtcgttcggtgtgtcccgggtgaccgcctgggaggaactacctgcc
gcgatcgcacacgcgcgtcagtacgacccgaaggtgattgtcgaggcggcgatcgtcggc
cgcgaactggagtgcggagtgctggagttccccgacggggatactcgggccagcgtgctc
ggcgaaatccgggtcgagggagtgaatagggaccagacggctgcgggtgccttctacgac
ttcgagaccaagtacctggacgacaccgccgaattggacgtaccggccaaggtcgacgac
gacgtgagcgatcagatccgcgaacttgccgtggccgcgttccgggcgatcgactgccag
gggctggcccgggtcgatttcttcctcgccgaggatggcccgctgatcaatgagatcaac
accatgccggggttcaccaccatctccatgtacccgcggatgtgggatgcgaccggcgtg
gactatccgacgctgctggacgcgatggtgcgcaccgcgctggcgcggggtaccggcctt
cgctga

DBGET integrated database retrieval system