KEGG   Mycobacteroides abscessus ATCC 19977: MAB_3579cHelp
Entry
MAB_3579c         CDS       T00657                                 

Definition
(RefSeq) Putative acyl-CoA synthase/polyketide synthase
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 5966078
NCBI-ProteinID: YP_001704308
UniProt: A0A0U0Y706
LinkDB All DBs
Position
complement(3625447..3627192)
Genome map
AA seq 581 aa AA seqDB search
MQTTYDFTDYFSTVTEWVARQPDQIALGYLEEGAGELTERAWTYAELVSHATAVAARLRE
DLEPGDRTLLLYPPGLPFVAAFLGCLAAGVVAVPAPLPDGRDKAQHRLAGIIADAGTRVV
LTESSVAPLIAGWADALPTPIALIATDAIPVELGREFVPVRSAPSDTAFLQYTSGSTNAP
KGVIVTHGNLVHNEQELGARIENDPSFSMLSWLPQFHDMGLIGMLLWPLFYGGTSRFLSP
VTFIKHPIQWIRAMSKYRATVGVAPNFAFDLVARRCTHEALEGVDLSCVRSLLNGSEPVQ
WASIERFTTLLAPFGLAEHAVTPVYGLAEATLFVTGDPHGTPVTTAVVDGEALAENRLVV
ANEGAPRSRVLVASGRIGGIEVSVVGADGAPLPDGEIGEIWLRGTSVAAGYWNLPELSAE
IFGATPIGGTGGWLRTGDLGTLVDGNLFITGRTKDVIIVNGRNLYAHDIEAAARAAAPAL
ARGVGAAFAVGTPERLVLVHEIRPENLGDASLDDVLAAVRTAIFAEFATPLSDLVLVAKG
EVARTTSGKIRRTHMRASYEGGRITAFADPRLASAGGDVVR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgacgtacgatttcaccgactacttcagcaccgtcaccgaatgggttgcccga
caaccggatcagattgccctgggctacctggaagaaggtgcgggcgaactgacggagcgc
gcgtggacctacgccgaactcgtaagtcatgccaccgccgtggccgcacgtcttcgtgaa
gacctggagcccggggaccgtaccctgctgctgtatccgcccgggctaccctttgtcgcg
gcgtttcttggctgcttggctgccggagtggttgcggttcccgctccactgcccgatggt
cgtgacaaggcgcagcaccgtcttgccggcatcatcgcggacgcgggcacacgcgttgtg
ctgacggagtcgtcggttgcgccacttatcgcgggctgggccgacgcgctgcccacgccg
atcgcgctcatcgccaccgatgcgattcccgtcgagctggggcgcgaattcgttccggtg
cggtcggcgccttccgataccgccttcctgcagtacacgtcgggttcgaccaatgccccg
aagggtgtgatcgtcacccacgggaacctcgtccacaacgagcaggaactcggagcccgc
atcgagaatgacccgtcgttctcgatgctcagctggctgccgcagtttcatgacatgggc
ctgatcggcatgctgctctggccgttattctacggcggcacttcgcgtttcctgtcacct
gtgacgtttatcaagcatcccatccagtggatccgggccatgtcgaagtaccgggcgacc
gtaggagtggcaccgaacttcgccttcgacctggtggcacggcgctgcacgcacgaggcg
ctcgagggtgtcgatctgtcgtgcgtacggtcgctactcaacggatcggagcccgtgcag
tgggcttctatcgagcggttcaccacgctgctggctccgttcggactcgcggagcatgcg
gttaccccggtgtatgggcttgccgaagccacgttgttcgtgaccggcgatccgcacggc
acgccggtcaccaccgccgttgtcgacggtgaggcgcttgccgaaaatcggttggtggtc
gccaacgaaggcgcgccacggtcccgagtgctggttgccagcggccgcatcggtggtatc
gaagtttcggtcgtcggagccgacggtgcacctctgcccgacggcgaaatcggcgagatc
tggctgcgcggaacgagtgtggccgctgggtattggaaccttccggagttgtccgccgag
atattcggcgcgacaccgatcggcggcacgggcggctggttgcgtaccggggacctgggc
accctggtcgatggcaacctcttcatcaccggtcgcaccaaggacgtcatcattgtcaac
ggccgcaatctctacgcccatgacatcgaggcggccgcgcgtgcggccgccccggccctg
gcacgcggggtgggcgcggcattcgcggtcggcacccctgagcggctcgtgctggttcac
gagatccgcccggagaatcttggtgatgcctcccttgacgacgtgctcgcggcggtacgc
accgcgatattcgccgaattcgccaccccgctgagcgatttggtgctggtggccaagggg
gaggtagcccgtaccaccagtggcaagatccgtagaacccatatgcgagcctcctatgag
gggggccggatcacggcgttcgcggatccgcggctggcctccgccggcggggacgtcgtc
cggtga

DBGET integrated database retrieval system