KEGG   Mycobacteroides abscessus ATCC 19977: MAB_3740cHelp
Entry
MAB_3740c         CDS       T00657                                 

Definition
(RefSeq) Probable glutamate decarboxylase GadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00250  Alanine, aspartate and glutamate metabolism
mab00410  beta-Alanine metabolism
mab00430  Taurine and hypotaurine metabolism
mab00650  Butanoate metabolism
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab02024  Quorum sensing
Module
mab_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MAB_3740c
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAB_3740c
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAB_3740c
   00430 Taurine and hypotaurine metabolism
    MAB_3740c
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MAB_3740c
Enzymes [BR:mab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MAB_3740c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 5966238
NCBI-ProteinID: YP_001704468
LinkDB All DBs
Position
complement(3793144..3794574)
Genome map
AA seq 476 aa AA seqDB search
MSKSRDQFRLSAHAGKINASAFSPAYTGRLSTAPVPALRLPDEPMDPQAAYRFIHDELML
DGSSRLNLATFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIESRCVAMVADLFHADN
LSTEDPSSAVGVSTIGSSEAVMLAGLALKWRWRTKIGGTDGTGWKGRTPNLVMGSNVQVV
WEKFCRYFDVEPRYLPMAKGRYVITPEQVLEVVDEDTIGVVGILGTTFTGELEPIAAICA
ALDKLAATPGKPDVPVHVDAASGGFVVPFLHPELHWDFRLPRVVSINVSGHKYGLTYPGI
GFVVWRGKEHLPEDLVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYAQVMR
CLSETARWFGDELGKSEHFEVITDGSAIPVVSFRLKGKRPYTEFDISHSLRAFGWQVPAY
TMPDDVTDIAVLRVVVREGFSGDLARALRDDLNTVLKGLDELKPNGHFDEVQPFAH
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaatcccgtgatcagttccgtctctcggcgcatgccggaaagatcaatgcctcc
gccttcagccccgcgtacaccggcaggctgtccacggcacccgtcccggcgctgcgactg
cccgacgagccgatggatccgcaggccgcctatcggttcattcacgacgagctgatgctc
gacggcagctcgcggctgaacttggcgaccttcgtcacgacgtggatggatcccgaggcc
gaaaagctgatggccgagacgttcgacaagaacatgatcgacaaggacgagtatccggcg
acggccgcgatcgagtcgcgatgtgtggccatggtggccgacctgttccatgccgacaac
ttgtccacggaggatccgtcctcggcggtaggggtgtcgaccatcggatcgagtgaggcg
gtcatgctggccgggctggccctcaagtggcgttggcgcacgaaaatcggcggtaccgac
ggcaccggctggaaggggcgcacacccaacctggtgatgggttccaacgtgcaggtggtc
tgggaaaaattctgccggtacttcgacgtcgaaccgcgatacctgccgatggccaagggc
cggtacgtgatcactcccgagcaggtgcttgaggtggtcgacgaggacaccatcggcgtc
gtcgggatcctgggcaccacgttcaccggagagctggagccgatcgccgcgatctgcgcg
gcgctggacaagctcgctgctacacccggcaagcccgatgtgccggtacacgtcgatgcc
gccagcggtggtttcgtggtgcctttcctgcatcccgaactgcactgggacttccggttg
ccgcgggtggtgtcgatcaatgtcagcggacacaagtacgggctgacctatcccgggatc
ggctttgtggtgtggcgcggcaaggagcatctgcccgaagacctggtgttccgggtcaac
tacctgggtggcgacatgccgaccttcaccctgaacttttcccgcccgggcaaccaggtg
gtggggcagtactacaacttcttgcggctgggccgggccggatatgcacaggtgatgcgc
tgtctgtcggagacggcacgctggttcggcgacgaactcggcaagagtgaacatttcgag
gtgatcaccgacgggtcggcgatcccggtggtgtcgttccggctcaaaggcaagcggccg
tacaccgagttcgacatctcgcattcgttgcgggcatttggctggcaggtgcctgcgtac
accatgcccgatgacgtcaccgatatcgccgtactgcgagtggttgtgcgcgagggcttc
tcgggagatctggccagagcgctgcgcgatgatctcaacaccgtgctcaagggactcgac
gagctgaaaccgaacggacacttcgacgaggtgcagccgttcgctcattag

DBGET integrated database retrieval system