KEGG   Mycobacteroides abscessus ATCC 19977: MAB_4417cHelp
Entry
MAB_4417c         CDS       T00657                                 

Definition
(RefSeq) Probable aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00250  Alanine, aspartate and glutamate metabolism
mab00410  beta-Alanine metabolism
mab00640  Propanoate metabolism
mab00650  Butanoate metabolism
mab01100  Metabolic pathways
mab01120  Microbial metabolism in diverse environments
Module
mab_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MAB_4417c
   00650 Butanoate metabolism
    MAB_4417c
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAB_4417c
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAB_4417c
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mab01007]
    MAB_4417c
Enzymes [BR:mab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MAB_4417c
Amino acid related enzymes [BR:mab01007]
 Aminotransferase (transaminase)
  Class III
   MAB_4417c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF982
Motif
Other DBs
NCBI-GeneID: 5966876
NCBI-ProteinID: YP_001705141
LinkDB All DBs
Position
complement(4495059..4496264)
Genome map
AA seq 401 aa AA seqDB search
MVAARGQGCYLYDETDREYLDFTAGIGVVSTGHCHPRVVEAAQRQVATLIHGQYTTVMHR
PLQNLVRRLGEVLPPSLNSLFFANSGSEAVEAAVRLARQATGRPNIIVFQGGFHGRTLAA
ATMTTSGPRFSSGIGPLMAGVYSAPFPTAYRYGWSEAEATRFALQELDYLFATATAPGQV
AAMVIEPVLGEGGYIPANTEFLTGIAERAREHGILLVLDEVQTGFGRTGQYFGHQHFGVT
PDVLVMAKGIASGFPISGIAASAELMGRAWPGSQGGTYGANAVACAAALATLDVIDEEGL
VDNARARGQELLDGARKIAADRGIDGDVRGLGLMVGVEFSQDGRPAPQRAARAQAAAAEN
GLLLLMCGPHMNVVRMIPPLVVTADQISDALGIWSSVVAGL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcggcgcgaggccagggttgctatctgtacgacgaaacagaccgcgaatacctg
gatttcaccgcgggaatcggtgtggtgagcaccggccattgccatccgcgcgtggtcgag
gccgcgcagcggcaggtagccaccctcatccacgggcagtacacgacggtgatgcaccgc
ccgctgcagaatttggtgcggcgcctcggcgaggtactgccgcctagcctgaattcactg
tttttcgccaactccggcagtgaagccgtcgaggctgccgtgcggctggcgcgtcaggcc
accggacgtcccaatatcattgtgttccagggcggatttcatggccgcacactggccgcc
gccacgatgaccacctccggcccgcggttctcatcgggaatcggtccactgatggcgggt
gtatacagcgctcccttccccacggcgtatcggtacggctggagcgaggccgaggccaca
cggttcgcgctacaagagctcgactacctgttcgcgacggccaccgccccgggccaggtc
gcggcgatggtcatcgagccggtgctcggcgagggtggctacatccccgccaacaccgaa
ttcctcaccggcattgccgagcgcgcgcgcgagcatggcatcctcttggtcctcgacgag
gtgcagaccggattcgggcgcaccgggcaatacttcgggcaccagcatttcggcgtcaca
ccggatgttctggtgatggccaagggaatcgcgagcggattccccatctcgggcatcgct
gcctccgccgagttgatggggcgtgcctggccgggttcgcagggcggcacctacggggcc
aacgccgtcgcatgtgccgctgcgctggccactctcgatgtgatcgacgaggagggcctc
gtcgacaatgcgcgtgcgcggggccaggaacttctggatggggctcgaaagatcgccgct
gacagaggaatagatggggacgtacgcggcctcggactgatggttggcgtggagttcagc
caggatggccgaccggcaccgcaacgtgcggcgcgggcacaggcagcagccgccgagaac
ggtctattgctactcatgtgcggcccgcacatgaacgtggtgcgcatgattccgccgctg
gtggtgacggccgatcagatatccgatgccctcggtatctggagcagtgtggtggcgggg
ctgtga

DBGET integrated database retrieval system