KEGG   Mycobacteroides abscessus ATCC 19977: MAB_4879cHelp
Entry
MAB_4879c         CDS       T00657                                 

Definition
(RefSeq) Putative phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00630  Glyoxylate and dicarboxylate metabolism
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MAB_4879c
Enzymes [BR:mab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     MAB_4879c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD HAD_2 Hydrolase_like Hydrolase MoCF_biosynth NIF Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 5967336
NCBI-ProteinID: YP_001705601
LinkDB All DBs
Position
complement(4987130..4987786)
Genome map
AA seq 218 aa AA seqDB search
MPLTVVYDWNGTLLDDADAFTTSINTILTHFRRPEIDAETLREICEFPFSRLYEKLGLPA
AAQDNDNELFFGSYQPLAATSGLRIGAERALEAFKESADVLILSNHIEHLIREHIALLGV
ESKIAHILAYASRESQYQGFTKGQMLQRYMREQDISPQHTVIVGDTPEEIRIAQSLGLTS
VAMTGGMASESRLRNAGADHVVHDHDELLAVLTRENLL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcactgtcgtctatgactggaacggaacgctgttagatgatgccgacgctttc
accacatccatcaacaccatccttacccatttccggcgtcccgagattgacgccgaaaca
ctgcgtgagatatgcgaattcccgttcagcaggctctacgaaaagttggggctaccggcc
gcggcccaggacaacgacaacgagctgttcttcggcagctaccagccgctagcggccacg
tctggattgcgtattggcgccgagcgtgcactcgaggcctttaaagagtcagccgatgtg
ctgattctcagtaaccacatcgaacacctcatccgcgagcacatcgctctactaggtgtc
gagagcaagatcgcccacatcctggcctacgccagccgggaatctcaataccaaggcttc
accaaaggccagatgctgcagcggtatatgcgcgaacaagacatctcaccgcagcacacc
gtgatcgtcggcgacacccccgaggaaatccgcatcgcccaatcgctggggcttaccagc
gtcgcgatgacaggcggcatggcttcagaatcgcgactacgcaatgcaggagcagatcac
gtcgtgcacgaccacgacgaactcctggctgtgctcacacgcgagaacttgctatga

DBGET integrated database retrieval system