KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_0034Help
Entry
MASS_0034         CDS       T02682                                 

Definition
(GenBank) putative serine/threonine-protein kinase PknA
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
Brite
KEGG Orthology (KO) [BR:mabb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mabb01001]
    MASS_0034
Enzymes [BR:mabb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MASS_0034
Protein kinases [BR:mabb01001]
 Serine/threonine kinases: Other
  Bacterial family
   MASS_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Kinase-like Haspin_kinase RIO1 ABC1
Motif
Other DBs
NCBI-ProteinID: AGM26636
UniProt: R4UN60
LinkDB All DBs
Position
complement(31905..33167)
Genome map
AA seq 420 aa AA seqDB search
MTVRVGETLSGRYRLQRLIATGGMGQVWEGTDSRLGRKVAVKVLKAEFSSDPEFIERFRA
EARTVAMLNHPGIASVYDYGETDIDSEGRTAYLVMELIHGEPLNSVLKRTGRLSLRHSLD
MLEQTGRALQVAHAAGLVHRDVKPGNILITPTGQVKLTDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDATPASDVYSLGVVGYEAVSGKRPFSGDGALTVAMKHIKETPSPLPAD
LPPNVRELIEITLVKNPQNRYTSGGPFADAVAAVRAGRRPPRPNQAPTISRATPAAIPPA
TQVRPAVGAPSRVAPPTSRTRQPTGSHRPPPPRRGTFSPGQKALMWAAAVLGIFAIIIAA
LILLQASEKKNQTPSIPATVSGSETPSSPGSASPGALAPANIVALLPDAEPDPIPGTKSP
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcgtgtgggagaaacgctctcaggccgttaccggttgcaacgactcatcgcg
accggcggtatgggccaggtctgggagggtaccgacagccggctgggccgcaaggtggcc
gtgaaggtactcaaggccgagttttcctcggatcccgagttcatcgagcggttccgcgcc
gaggcccgcaccgtcgcgatgctgaaccatcccgggatcgccagcgtctacgactacggc
gagaccgatatcgacagcgagggccgcacggcctatctggtcatggagctgattcacgga
gagccgctgaactcggtgctcaaacgcaccggccgcctctcgctgcgccactccctggac
atgctggagcagaccggccgtgcgcttcaggtcgcacacgcggcgggtctggtgcaccgc
gacgtcaaaccgggcaacatcctcatcacgcccaccggccaagtgaaactcaccgacttc
ggcatcgccaaggccgtcgatgcggccccggtcacgcaaaccggcatggtgatgggtacc
gcgcagtacattgcccccgaacaggcgctgggccatgacgcgacccccgccagcgacgtg
tactcactgggagtggttggctacgaagcggtttcgggtaagcggccgttctccggtgac
ggtgcactgaccgtcgcgatgaaacacatcaaggaaacgccgtcgccgctgcccgccgat
ctgccgccgaacgtgcgcgagctcatcgagatcaccctcgtgaagaacccgcagaaccgg
tacaccagcggcggcccattcgccgacgcggtggctgcggtgcgtgcgggacgccgtcct
ccgcggcccaaccaggcgcccaccatcagccgcgcgacgccggctgcaatcccccccgcc
actcaggtacggcccgccgtgggcgcaccgagtcgggtggccccgcccacctcacgtacc
cgtcagccgacgggctcgcaccggccgccaccgccccggcgcggcaccttctcaccgggc
cagaaggccctcatgtgggcggccgccgtgctgggcatcttcgccatcatcatcgcggcg
ctcatcctgttgcaggcgagtgagaagaagaatcagacaccgagcatccctgcaacggtt
tccggtagtgagacaccctcaagcccaggttcagcttcgccaggagcgctcgcgccagct
aatatcgtggctctgcttccggacgccgagccggacccgatccctgggacgaaatcaccg
taa

DBGET integrated database retrieval system