KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_0494Help
Entry
MASS_0494         CDS       T02682                                 

Definition
(GenBank) dehydrogenase
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AGM27096
UniProt: R4UPF4
LinkDB All DBs
Position
complement(542171..543202)
Genome map
AA seq 343 aa AA seqDB search
MRASVLRNGSMVYRDDVPSPTPGEGQVLVKVSACGICGSDLHFAKHGARAIALTKQMSGM
PSLTDGVDLGADVFMGHEFAAEVIEAGPRTQAPAPGAAVTSIPILLSAKGLQPIVYSNTT
LGGYAEQMLLSAPLLLPIPNGLDPRHAALTEPMAVGLHAVNKSGIQLGTGAIVIGCGPVG
IAVIAALHNLGIEPIVASDYSSARRDLAQRMGAHRVVDPKIEPTFHAWSRIGAGAPVIFE
AVGVPGILNEVLRDAPHSARVVVVGVCMEPDAITPYFGIAKEVAVQFVLAYEPAEFSETL
RRIAHGEIDVAPLVTGEVGLEDVGSAFADLGDPERHCKILVVP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgtcggtgctacgcaacggctcaatggtctatcgcgatgatgtgcccagtcct
acaccgggcgaggggcaggtgctggtcaaggtgtccgcttgtggcatctgcggatccgac
ctgcatttcgccaaacacggcgcgcgggccatcgcgctgaccaagcagatgtcgggcatg
cccagtctcaccgacggcgtcgacttgggcgccgatgttttcatgggccacgagttcgcg
gcagaagtgatcgaggccgggccgcggacgcaagcacccgcccccggagccgcggtaacc
tcaattccaatcctcctgtctgccaagggcctccaacccatcgtctacagcaacaccacc
ctcggcggctatgccgaacagatgctgctcagtgcgccgctgctgctgcccatccccaac
ggcctcgatccccgacacgcggccctgaccgaacccatggctgtcggcctgcatgccgtc
aacaagtcgggcatccagctgggcaccggagcgatcgtcatcggttgcggccccgtcggt
attgccgtgatcgccgccctgcacaacctgggtatcgagcccatcgtcgcctccgactac
tcctctgcccgacgcgatctggcgcaacgcatgggcgcgcaccgagtggtcgaccccaag
atcgagcccaccttccacgcctggtcccggataggcgccggtgcgcccgtgatcttcgag
gccgttggagtgccgggcatcctcaacgaggtcttgcgcgacgccccgcacagcgcacga
gtggtggtcgtgggcgtctgtatggagcccgatgccatcaccccctacttcgggatcgcc
aaggaagttgcggtgcagttcgtgctcgcctacgagcccgccgaattctccgaaacgctg
cgtcgaatcgcgcacggtgagatcgatgttgcgccgctcgtcacaggtgaggtaggtctg
gaagatgtcggttcggcatttgccgatctcggcgatcccgagcgccactgcaagatcttg
gtggtgccatga

DBGET integrated database retrieval system