KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_1028Help
Entry
MASS_1028         CDS       T02682                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
Pathway
mabb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mabb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MASS_1028
Enzymes [BR:mabb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MASS_1028
DNA repair and recombination proteins [BR:mabb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MASS_1028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AGM27630
UniProt: R4UNI2
LinkDB All DBs
Position
1069564..1071915
Genome map
AA seq 783 aa AA seqDB search
MERISPVWPTGAAESARSGRGATAFVRLSNAEKVLYPATDTSSATTKADVFGYYTAIAPF
MLPHIAGRPVTRKRWPNGVDQPSFFEKDLASSAPDWLPRRRIEHKSRYVSYPLIDTSVAL
AWIAQQAALEVHVPQWRFAGENPGPATRLVFDLDPGEGVGMAQLAEVARAIRDVLADIGL
KTFPVTSGSKGLHLYVPLAQPASSSGAVAVAKKVAVQLEQAMPDLVTATMTRQLRAGKVF
VDWSQNSGSKTTVAPYSLRGRAVPTVAAPRTWEELDDPGLRQLRYDEVLTRAQRDGDLLA
GLDDVEIAEDRLSTYRSMRDPARTPEPVPAIKPEAGQNNSFVIQEHHATALHYDFRLERD
GVLVSWAVPKNLPLEPSVNHLAVHTEDHPLEYGSFEGTIPKGEYGAGEVTIWDSGTYDTE
KFIDPRDDSGADGGQKGEVIVTLHGKRITGRYALIRTSGKQWLAHRMKDQRPAGSMPIGL
APMLPTTGSVAGLTAEEWAFEGKWDGYRLILECDRGQLRALARSGRDVTAEFPALQRLAH
ELSDHRVVLDGEVVVPDQKGLPSFALLQNRTPGADIRFWAFDLLYLDGKSLLRTKYRDRR
RLLEVLVTGAESMTVPRQLSGDGAAALAYSQDQGWEGVVAKRLDSPYVPGRTQSWIKAKN
WRSQEVVIGGWRKGQGGRSSGIGALLMGIPVEGGLRYAGRVGTGFTEKELSSLKERLEPL
HRAESPFDAPLSTVEAKDVQFVEPVLVAEVRYGDRTPGGILKHSSWRGLRTDKSVRDVEL
DLG
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcatatccccagtatggcccaccggagccgcggagtcggcgagatccggccgg
ggggcaaccgcgttcgtccggctgtccaacgccgagaaagtgctgtacccggccacggat
accagctcggccaccaccaaagcggatgtcttcggctactacaccgcgatcgcccccttc
atgttgccgcatatcgcgggccggccggtcacccgcaagcggtggcccaacggcgttgac
cagccgtcgttcttcgagaaggacctggcttcttcggcgcccgactggctgccgaggcgc
cgtatcgagcacaagtcccgctacgtcagctacccgctgatcgacacctcggtcgccttg
gcgtggatcgcgcagcaggcggcgctcgaggtgcacgtgccacagtggcgattcgccggt
gaaaatccaggtccggcaacccggttggtgttcgacctggatcctggcgagggggtcggc
atggcccaactggcggaagtggccagggccatccgggatgtgctcgccgatatcggcctg
aagacctttccggtgaccagtggaagcaagggcttgcacctgtacgtgccgctggcgcaa
ccagccagctcgtccggtgcggtcgctgtggcgaagaaggttgccgtccagttggagcag
gcgatgcccgacttggtgacggcgacgatgacccgacagctacgcgcgggcaaggtcttc
gtggattggagccagaacagcggttccaagacgacggtggcgccctactcattacgtggc
cgggcggtgccgaccgtcgccgcgccgcgcacgtgggaagaactggacgaccccggcctg
cgtcagctgcgatacgacgaagtgctgacgcgggcccagcgtgacggcgacctgctggcc
gggctcgatgatgtcgagatcgccgaggacaggctgtccacctatcgcagcatgcgcgat
cccgcacgcacgcctgaaccggtaccggcaatcaaacccgaagctgggcaaaataattca
tttgtcatccaggagcatcacgccaccgcgctgcactacgacttccggctggagcgcgat
ggcgtgctggtgtcgtgggcggtgcccaagaacctgcccttggaaccgtcggtcaatcat
cttgcggtgcacaccgaggatcatccgctggagtacggctccttcgaaggcaccatcccg
aagggagagtatggggcgggcgaggtgacgatctgggactcgggcacttacgacaccgag
aagttcatcgacccgcgcgacgattcaggagccgacggcgggcaaaaaggtgaggtcatc
gtcaccctccatggcaagcgaatcaccgggcggtacgcgctgattcgaactagcggcaag
cagtggctggcgcaccggatgaaggatcagcggcccgcaggttcgatgcccatcggtctc
gcgccgatgttgccgaccaccgggtcggtggcgggtctgaccgccgaagaatgggcgttc
gaaggcaaatgggacggctatcggctgatcctggaatgcgatcgcggacagctcagggca
ttggcgcgcagcgggcgcgacgtcacggccgaattcccggcgttgcaacggcttgcgcat
gaactgtccgatcaccgagtggtgctcgacggcgaggtggtggtgccggatcagaagggc
ctgcccagctttgcgctgctgcagaacaggacaccgggcgccgacatcaggttctgggct
ttcgatctgctgtatctggacggaaaatcgttgttgcgtaccaagtatcgggaccgacgt
cgactgcttgaggtgcttgttaccggcgccgaatcgatgacagtgccgcggcagttgagc
ggcgacggtgccgcggcccttgcgtactcgcaggatcaaggctgggagggcgtggtggcc
aagaggctggattccccctacgttcccggccgaacacagtcttggatcaaggcgaagaac
tggaggagtcaagaggtcgtcatcggcggctggcgcaaggggcagggcggtcgcagcagc
ggaataggggccctgctcatgggaatacctgtcgagggtggtctgcgctatgcgggccgg
gtcggtaccggattcaccgagaaggaactgtcatcgctgaaggagcgtctggagcccctg
caccgcgccgaatcgccctttgatgcgccgctgtccaccgtcgaggccaaggacgtgcag
ttcgtcgagccggtgttggtggccgaagtccgatacggcgaccgcaccccgggcggaatt
ctgaagcactcaagttggcgcgggctgcgcaccgacaagtcagttcgcgacgtcgagctc
gatctcgggtag

DBGET integrated database retrieval system