KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_1977Help
Entry
MASS_1977         CDS       T02682                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
Brite
KEGG Orthology (KO) [BR:mabb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mabb01001]
    MASS_1977
Enzymes [BR:mabb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MASS_1977
Protein kinases [BR:mabb01001]
 Serine/threonine kinases: Other
  Bacterial family
   MASS_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like RIO1 Haspin_kinase Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AGM28579
UniProt: R4UL16
LinkDB All DBs
Position
complement(2002099..2003433)
Genome map
AA seq 444 aa AA seqDB search
MPASLDTIGAMTSPKSPTGRLDPMIGAVLDGRYRIEAPIATGGMSTVYRGLDTRLDRPVA
VKVMDSRYASDSGFLARFRLEARAVARLRHPGLVAVFDQGMDGRHPFLVMELIDGGTLRE
LLRERGPMPPHAVAAVFNPLLGGLAVAHRSGLVHRDVKPENVLISDDGEVKLADFGLVRA
VAEAGITSTSVILGTAAYLSPEQVRTGSAGPRSDVYSAGILMYELLTGSTPFTGDTPLAL
AYQRIDRDVQAPSEAIDGVPEEFDELVLRATSRDPDARYADAAQFGAELDAISSELRLPP
FRVPAPRDSKQHVAEQLYRSRLIDSGGNTTGNLSAPGKADAADAASAAAALGVSARPSTP
PRPRVPNPTRMMDPVPAYDAGYDEEFDGEPDESAFFADIDDSDYRYERQQSRRAIFIWLV
IVLILTSSVAAGCWSLGANITNLL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcatcactcgatacgatcggtgcgatgacatcgcccaagtccccgaccggccgc
ctcgatccgatgatcggcgcggtgctcgatggccggtatcgcatcgaagctccgatcgcg
acgggcggcatgtcgaccgtgtaccgagggctggacacccggctggatcgccccgtcgcc
gtcaaggtgatggacagtcgttacgcgtccgacagcgggtttctcgcgcgcttccggctg
gaggcgcgtgcggtggcccggctgcggcatccgggactggtggccgtcttcgaccaaggc
atggacggtaggcatcccttcctggtgatggagctgatcgacggcggcaccctgcgcgag
ctactgcgggaacgcggtccgatgccaccgcacgcggtggccgccgtgttcaatcccctg
ctgggtggtttggcggtggcgcatcgatcaggattggttcaccgcgacgtcaagcccgag
aatgtgctgatctccgacgacggcgaggtcaaactcgccgatttcggactggtccgtgcc
gtggccgaggcaggcatcacgtcgaccagcgtgatcttgggcaccgcggcgtacctatct
ccagagcaggtgcgcaccgggtcggccggcccacgcagcgatgtctactccgccggcatt
ctgatgtacgaactactcaccggctcaacaccattcacgggcgataccccgctggcgctg
gcctaccagcgcatcgatcgcgatgtgcaggcacccagcgaggcgatcgacggtgtcccg
gaggaattcgacgagctggtgttgcgtgccacctcccgcgacccggacgcacgctatgcc
gacgccgcacagttcggggcagaactggacgcaatctcctccgaactgcgattgccgccg
tttcgggtgccggctccccgcgactccaaacagcatgtcgccgagcagctgtatcgcagc
cggctgatcgattcgggcggcaataccaccggcaacctcagcgcccccggcaaggccgat
gccgccgacgccgcctcggccgcggccgccttgggcgtttcggcacggccgagcacccca
ccacgcccccgggtgcccaaccccacgcggatgatggaccccgtccctgcgtacgacgcc
ggttacgacgaggaattcgacggcgaaccagatgaatcggcgttctttgccgatatcgac
gactcggactaccgatacgaacgccaacagagccgccgcgccatcttcatctggctggtg
atcgtcctgatcctcaccagctcggtggcggcaggatgctggtcgctgggcgccaacatc
accaacctgctctag

DBGET integrated database retrieval system