KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_2463Help
Entry
MASS_2463         CDS       T02682                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
Pathway
mabb00380  Tryptophan metabolism
mabb00630  Glyoxylate and dicarboxylate metabolism
mabb01110  Biosynthesis of secondary metabolites
mabb01130  Biosynthesis of antibiotics
mabb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mabb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MASS_2463
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MASS_2463
Enzymes [BR:mabb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MASS_2463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AGM29065
UniProt: R4USF5
LinkDB All DBs
Position
complement(2518387..2520495)
Genome map
AA seq 702 aa AA seqDB search
MDHTSNPKQEQLDTSRVDRASGYLTTQQGVRVDHTDDALTAGVRGPTLLEDFHAREKVTH
FDHERIPERVVHARGAGAYGYFEPYDAWLSDFTAAKFLTTPGLRTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTQQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPDNEIPQAASA
HDTLWDFVAEQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNDAGEGVFVKFHWKP
LLGVHSLLWDECQQIAGKDPDFNRRDLWDAIESGQFPEWELGVQLVPESDEFKFPFDLLD
ATKIIPEEQVPVQPVGRMVLDRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPIAEVHNNQQDGFAQHDIPQGKSSYFKNTLGGGCPALAHE
DVFRHYTQRVDGHKIRQRAESFKDFYSQARMFWKSMSAIEAQHIVSAFSFELGKVSAESG
IRERVVAQLNLVEHDLASQVALQLGLPAPAPQSADEALPPSPALSQLSSTRDSVATRRIA
VLAADGVDIHGVDLLRTALEESDAIVEILAPTGGGTLTGESGGELRVDRAMTTMASVLYD
AVVVPSGAESAWRLARNGFAVHFVSEAYKHLKPVAAYGAGLDLLRAASVVETLATTTEIV
VDDGVVTTTAEASALPAEFVAAFVTAISRHRAWERETEMVPA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtggaccacacgtcgaatcccaaacaagagcaactcgacacgtctcgggtggaccgcgcc
tctggttatctcactacccagcaaggcgttcgcgtcgaccacaccgatgacgcgctcacc
gccggcgtcaggggccccacgttgctggaggatttccacgcgcgcgagaaagtcacgcat
tttgaccacgaacgaattccagagcgtgtggttcatgcgcgcggcgcgggcgcatacggc
tatttcgagccgtacgacgcgtggctatcggacttcacagccgcgaaatttctcaccaca
cccggcctccgcacaccggtgttcgttcgtttctctaccgttgcgggctcccgcggctcg
gcagacaccgtgcgcgacgtacgtggatttgccacgaaattctatacacagcaaggaaat
tacgatctggtcggtaacaatttcccggtattcttcatccaggacggcatcaaattcccg
gacttcgtgcacgcggtgaagcctgagcccgacaacgagatcccgcaggccgcctcggcg
catgacaccttgtgggacttcgtggccgagcagcccgagacgctacacgcgatcatgtgg
ctcatgtccgatagggctctgccccgcagctaccgcatgatgcaagggttcggcgtacac
accttccgattggtcaacgacgccggcgagggcgtttttgtgaagttccactggaagccg
ctgctaggcgttcactcactgctgtgggacgaatgtcagcagatcgccggcaaggacccc
gatttcaaccggcgcgatctctgggacgcgatcgagtccggccagtttccggaatgggag
ctcggagtgcaactggtaccggaatccgacgagttcaaattccccttcgaccttcttgac
gcaacgaaaatcattccggaagaacaggttccggtgcagcctgtcggacgcatggtgctg
gatcgcaaccccgacaacttctttgccgagacagaacaggtcgcattccacacggccaat
gtggtgccgggaatcgacttcaccaacgacccgctgcttcagtttcgtaacttctcctac
ctggatacacaactgatccgcctaggcggcccgaacttcgcacaactgcccatcaacaga
ccgatcgccgaggtgcacaacaaccagcaagacggcttcgcgcagcacgacatcccacaa
ggcaagtcaagctatttcaagaacaccctcggcggcggctgcccggccctggcgcatgaa
gatgtcttccgccactacacccaacgagtggacgggcacaagatccgccagcgcgccgag
agcttcaaggatttctacagccaggcgcggatgttctggaagagtatgtccgccatcgag
gcgcagcacatcgtttcggcgttctcgttcgaactgggcaaggtgagtgccgagtccggg
attcgcgaacgtgtggtcgctcaactcaacctggtggaacacgatcttgcttctcaagtc
gccttgcagctgggcttacctgccccggcgccgcaatcggccgacgaggctcttccgccg
tccccggcgctgtcccagctctccagcacccgagacagcgtcgccacccgacggatcgcg
gtgctcgcagccgacggtgtcgacatccatggcgtggatctccttcgtacggcgctggaa
gagagtgacgcgattgtcgagatactcgcaccgactggcggcggaacgctcaccggcgaa
tccggcggcgaactccgcgtcgaccgcgcgatgaccaccatggcctcggtgttatacgac
gccgtggtcgtaccgtccggagccgaatccgcctggcggctggcgcgcaacggattcgcc
gtgcatttcgtttccgaggcctacaaacatctcaagcccgtcgcggcctacggtgccggg
ctcgatctgctccgggcagcctctgtggtggaaacactcgccaccaccacagagattgtg
gttgacgacggcgtggtgacgaccaccgcggaagccagtgcattgccggccgaattcgtc
gccgcgtttgtcacggcgatcagccggcatcgcgcctgggaacgcgagaccgagatggtg
cccgcatag

DBGET integrated database retrieval system