KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_3689Help
Entry
MASS_3689         CDS       T02682                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
Pathway
mabb00020  Citrate cycle (TCA cycle)
mabb00190  Oxidative phosphorylation
mabb00650  Butanoate metabolism
mabb01100  Metabolic pathways
mabb01110  Biosynthesis of secondary metabolites
mabb01120  Microbial metabolism in diverse environments
mabb01130  Biosynthesis of antibiotics
mabb01200  Carbon metabolism
Module
mabb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mabb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mabb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mabb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MASS_3689
   00650 Butanoate metabolism
    MASS_3689
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MASS_3689
Enzymes [BR:mabb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MASS_3689
    1.3.5.4  fumarate reductase (quinol)
     MASS_3689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AGM30291
UniProt: R4UYI8
LinkDB All DBs
Position
3699096..3700862
Genome map
AA seq 588 aa AA seqDB search
MGSPIIQEHRYDVVIIGAGGAGMRAAVEAGPRARTAVLTKLYPTRSHTGAAQGGMCAALA
NVEEDNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGMPFNRTPQGRIDQRR
FGGHTRDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDIALTETPNGP
VATGVVAYELATGDIHVFHAKAIVFATGGSGRMYKTTSNAHTLTGDGLGIVFRKGLPLED
MEFHQFHPTGLAGLGILISEAVRGEGGRLLNADGERFMERYAPTIVDLAPRDIVARSMVL
EVLEGRGAGPNKDYVYIDVRHLGADVLEAKLPDITEFARTYLGVDPVTELVPVYPTCHYV
MGGIPTNIHGQVLRDNDNVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAAA
EYAEAHDFIDLPENPATMVTEWVADVLSEHGDERVADIRTELQQSMDNNAAVFRTEDTLK
QALNDIHALKERYSRITVHDKGKRYNSDLLEAIELGFLLELAEVTVVGALNRKESRGGHA
REDYPNRDDTNYMRHTMAYKQGAELLSDIRLDYKPVVQTRYEPMERKY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccccatcattcaggaacatcggtacgacgttgtcatcatcggcgcgggcggt
gcgggtatgcgcgccgccgtggaggccggaccccgagctcgtaccgcggtactgaccaag
ctgtacccgacacgtagccacaccggggcagcccagggcggcatgtgcgccgcgctggcc
aacgtcgaagaagacaactgggaatggcacaccttcgacaccgtcaagggtggcgactac
ctcgccgaccaggatgccgtggagatcatgtgcaaggaggcgatcgacgccgtcctcgat
ctcgaaaagatgggtatgccgttcaaccggaccccccagggcagaatcgatcagcgccgc
ttcggtggccacacccgcgatcacggtaaggcgccggtacgccgggcctgctacgccgct
gaccgcaccggacacatgatcctgcagacgctgtaccaaaactgcgtcaagcacgatgtc
gagttcttcaacgagttctacgcactggacatcgcactcaccgagacgccgaacggcccg
gtggccaccggcgtcgtcgcctacgagctggcgaccggcgatatccacgtgttccacgcc
aaggcaattgttttcgccaccggtggctcgggccgtatgtacaagaccacctccaacgcg
cacaccctgaccggcgacggcctgggcatcgtgttccgcaagggacttccgttggaggac
atggaattccaccagttccacccgacaggccttgccggcctgggaattctgatctccgaa
gccgtccgtggggagggtggccgtctgctcaacgccgacggcgagcgcttcatggagcgc
tatgcccccaccatcgttgacctcgcgcctcgcgacatcgtcgcgaggtcaatggttctc
gaagtgctcgaaggccgtggcgccggaccgaacaaggactacgtctacattgacgtgcgt
catctcggtgcggacgtgctggaagccaagctgccggacatcaccgaattcgcgcgcacc
tacctgggcgtcgacccggtgaccgagctggttccggtgtaccccacctgccactacgtg
atgggcggtatcccgaccaatatccacggccaggtgctacgcgacaacgacaacgtggtt
cccggcctgtacgcagccggcgaatgcgcctgcgtgtcggtgcacggcgccaaccggctg
ggcaccaactcgctgctggacatcaacgtgttcggtcgccgggcgggcatcgccgcggcc
gagtacgccgaggcccacgacttcatcgatctgccggagaacccggcgacgatggtcacc
gaatgggtggcggacgtgctgtccgagcacggcgacgagcgggtggccgacatccgtacc
gaactgcagcagtcgatggacaacaatgccgcggtgttccgtaccgaagacaccctcaag
caggcgctcaacgacatccacgcactcaaggagcggtacagccgaatcacggtgcacgac
aagggcaagcgctacaacagcgacctgcttgaggccatcgagctcggcttcctgctcgag
ctcgccgaggtgaccgtggtgggcgcactcaaccgcaaggaatcgcgtggcggccacgcc
cgcgaggactaccccaaccgcgacgacaccaattacatgcgacacaccatggcgtacaag
cagggtgccgagctgctgtccgacatccggctggactacaagcccgttgtccagacccgg
tacgagccgatggaacggaagtactga

DBGET integrated database retrieval system