KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_3690Help
Entry
MASS_3690         CDS       T02682                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
Pathway
mabb00020  Citrate cycle (TCA cycle)
mabb00190  Oxidative phosphorylation
mabb00650  Butanoate metabolism
mabb01100  Metabolic pathways
mabb01110  Biosynthesis of secondary metabolites
mabb01120  Microbial metabolism in diverse environments
mabb01130  Biosynthesis of antibiotics
mabb01200  Carbon metabolism
Module
mabb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mabb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mabb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mabb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MASS_3690 (sdhB)
   00650 Butanoate metabolism
    MASS_3690 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MASS_3690 (sdhB)
Enzymes [BR:mabb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MASS_3690 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     MASS_3690 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_18 Fer4_9 Fer4_7 Fer4_4 Fer4_15 Fer4 Fer4_16 Fer4_2
Motif
Other DBs
NCBI-ProteinID: AGM30292
UniProt: R4UEU0
LinkDB All DBs
Position
3700864..3701646
Genome map
AA seq 260 aa AA seqDB search
MTAVIEKAEAGDPPLPPVPEGAVMVDLKIQRFNPEDPDAAGWQTFRVPCLPTDRLLNLLL
YVKGYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDLLPKNPKKTLTITIEPIR
GLPVEKDLVVNMEPFFDAYRAVKPFMITSGNQPTREYIQSQTDRARFDDTTKCILCACCT
TSCPVFWSDGSYFGPAAIVNAHRFIFDSRDEAAAERLDILNDVDGVWRCRTTFNCTDACP
RGIEVTKAIQEVKRALMFAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggttatcgagaaagccgaagcaggcgacccgccgctgcctccggtccccgag
ggcgcggtcatggtggatctgaagatccagcgtttcaaccccgaagatcccgacgccgcg
ggatggcagacgttccgggtgccctgcctgcccacggaccggctgctgaacctgctgctg
tatgtgaagggctacctggatggcaccctgaccttccgccggtcgtgcgcacatggtgtg
tgcggttcggacgccatgcggatcaacggtgtgaaccggctggcctgcaaggtgctgatg
cgggacctgctgcccaagaaccccaagaagacgctcaccatcaccatcgagcccatccgc
ggcctgcccgtggagaaggacctcgtggtcaacatggagcccttcttcgacgcctaccgc
gcggtgaagccgttcatgatcaccagcggcaaccagcccacgcgcgagtacatccagagc
cagaccgaccgtgcgcgcttcgatgacaccaccaaatgcatcctgtgcgcctgctgcacc
accagctgcccggtgttctggagcgacggaagctacttcggcccggccgcgatcgtcaac
gcacaccggttcatcttcgacagccgcgacgaggccgccgccgagcgcctggacatactc
aacgacgtcgacggggtgtggcgctgccgcaccacgttcaactgcaccgacgcctgcccg
cgcggcatcgaggtgaccaaggcgatccaggaagtcaagcgcgccctgatgttcgcgcgc
tga

DBGET integrated database retrieval system