KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_4259Help
Entry
MASS_4259         CDS       T02682                                 

Definition
(GenBank) putative serine/threonine-protein kinase pknG
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
Brite
KEGG Orthology (KO) [BR:mabb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mabb01001]
    MASS_4259
Enzymes [BR:mabb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MASS_4259
Protein kinases [BR:mabb01001]
 Serine/threonine kinases: Other
  Bacterial family
   MASS_4259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR PknG_rubred Pkinase Pkinase_Tyr TPR_19 TPR_16 TPR_2 TPR_4 DZR APH zf-ribbon_3 TPR_1 RPN7 zinc_ribbon_9 Nudix_N_2 RIO1 HemY_N HscB_4_cys
Motif
Other DBs
NCBI-ProteinID: AGM30861
UniProt: R4V035
LinkDB All DBs
Position
4273999..4276260
Genome map
AA seq 753 aa AA seqDB search
MSEDPEEPDDTSADEGPGTQPASLADLDVDSASTMRPISTRAVFRPPDSTQPATQPTTQP
EVRATTTRVLLSPTRRLGGGLVEIPRVPEIDPLEALMTNPVVEESKRFCWNCGKPVGRST
TDSPAQSEGICPSCGSSFSFLPQLNPGDVIAGQYAIKGCIAHGGLGWIYLAVDRNVNDRP
VVLKGLVHSGDAEAQNIAMAERRFLAEVAHPSIVKIFNFVEHPDQHGNPVGYIVMEYVGG
TSLKQPKGSALPVAQAIAYMLEILPALGFLHSVGLTYNDLKPENIMITEEQLKLIDLGAV
ASINAYGNLYGTPGYQAPEISKTGPTVASDIYTVGRTLAVLTLRMPTRKGRYKDGLPSED
PVLAKYDSYHRFLRRAIDPDPSARFGSAEEMATQLVGVLREVVALDSGTPRPGMSTLFSP
SRSTFGVDLLVAHTDVYVDGLAHPPSLTAPDIVTALQVPLLDPTDVGAAILQATVLSQPI
QTLESLKAARLGRIDADGVDLTESVELPLMEARALLDLGDVAKANSKLDQLEDRVGTPWR
LTWYRGMAALLNGDYDQATKHFTAVLDFLPGEIAPKMALAATAELAGDEKNLDFYRTVWS
TDNSVISAGYGLARTLAARGERAEAVRMLDNVPPTSRHFTTARLTSAVTLLSGRTLSEVT
EDDIREAARRVEALPETEPRVLQIRALVLGTALDWIKSNHSTGHHILGVPFTKRGLRQGV
ERCLRALARRATERAHRYALVDLANATRPTSLL
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagatcccgaagaacccgacgacacatccgcggacgagggcccgggcacccag
cccgcgtcccttgccgatctggacgtcgactccgcctcgacgatgcggcccatctcgacg
cgcgcggtgttccgccccccggactcgacgcagcccgccacgcaacccaccactcaaccc
gaggtccgcgccaccaccacgcgggtactgctgtcgcctacgcggcgcctgggcggcgga
ctcgtggaaatcccgcgcgtaccagaaatcgatccgctggaagccttgatgaccaacccg
gtcgtcgaggaatccaagcggttctgctggaattgcggcaagccggtcggacgctccacg
acagacagtcccgcccaaagcgagggcatctgtcccagctgcggatccagcttctcgttt
ctaccgcaattgaatccgggcgacgtgatcgccgggcagtacgccatcaagggctgcatc
gcccacggcggattgggatggatctacctcgcggtggatcgcaacgtcaacgatcgcccg
gtggtgctcaagggtctggtgcactccggggacgccgaggcacagaacatcgcgatggcc
gagcggcgattcctcgccgaggtggctcatccctcgatcgtgaagatcttcaacttcgtc
gagcaccccgatcagcacgggaaccctgtcgggtacatcgtgatggaatacgtcggcggc
acctccctcaagcaaccgaagggtagcgctctcccggtggcgcaggccatcgcctacatg
ctggaaatccttcccgcactgggtttcctacattcggtgggtctcacctacaacgacctc
aagcccgagaacatcatgatcaccgaggagcagctcaagctcatcgacctgggcgcggtg
gcctcgatcaacgcctacggcaacctgtacggcacacccggctaccaggcgcctgagatc
tccaagaccggccccaccgtcgcctcggacatctacacggtggggcgaaccctggcggtg
ctgaccctgcgcatgcccacccgcaagggccgctacaaggacgggctgcccagcgaggat
cccgtgctggccaagtacgactcctaccaccggtttctgcgccgcgccatcgatcccgat
ccgagtgcgcggttcggcagcgccgaggagatggccacccagctcgtcggcgtgctccgg
gaggtggtggcgctggactccggcacaccacgacctggcatgtccaccctgttcagcccg
tcccgatccaccttcggtgttgatctgttggtggcacacaccgacgtctacgtcgacggg
ctcgcccacccgccgagcctgacggcccccgatatcgtgacagccctccaggttccgctg
ctggaccccaccgatgtgggtgccgcgatcctgcaggcaaccgtgctgagccagccgatc
cagaccctggaatcgttgaaggccgcgcgcctgggccggatcgacgccgacggtgtggac
ctgaccgaatcggtcgaactgccgctgatggaagcgcgcgcactcctcgatctgggcgat
gtcgccaaggccaatagcaagctcgaccagctcgaagaccgtgtgggcactccctggcgc
cttacctggtatcgcggcatggccgcgctactcaacggcgactatgaccaagcgacaaag
catttcacggctgtactggacttcttgcccggtgagatcgccccaaaaatggccctggcc
gcgaccgccgaacttgccggagacgagaagaatctcgacttctaccgcacggtctggtcc
accgataacagtgtcatctcagcgggttatgggctggcacgcacgctggccgcccgcggg
gagcgggcagaggcggtgcgcatgctcgacaacgtgccgccaacctcgcgccatttcacc
accgcgcgcctcaccagcgcggtcacgctgctgtcggggcggacactctcggaagtcacc
gaggacgatatccgcgaggccgcccgcagggtggaagcactgcccgagaccgagccacgg
gtgctgcagatccgggcgctggtgctgggcacggcactggactggatcaagagcaatcat
tcgaccggacatcacattctgggtgttccgttcaccaaacgcggtctgcgccagggggtt
gaacggtgcctgcgggcgttggcccgccgggccaccgaacgcgcccaccgctacgcgctg
gtcgatctggccaacgccacgcggccgacctcactgctctga

DBGET integrated database retrieval system