KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_4454Help
Entry
MASS_4454         CDS       T02682                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
Pathway
mabb00250  Alanine, aspartate and glutamate metabolism
mabb00410  beta-Alanine metabolism
mabb00640  Propanoate metabolism
mabb00650  Butanoate metabolism
mabb01100  Metabolic pathways
mabb01120  Microbial metabolism in diverse environments
Module
mabb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mabb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MASS_4454
   00650 Butanoate metabolism
    MASS_4454
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MASS_4454
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MASS_4454
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mabb01007]
    MASS_4454
Enzymes [BR:mabb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MASS_4454
Amino acid related enzymes [BR:mabb01007]
 Aminotransferase (transaminase)
  Class III
   MASS_4454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF982
Motif
Other DBs
NCBI-ProteinID: AGM31056
UniProt: R4V0M1
LinkDB All DBs
Position
complement(4464171..4465448)
Genome map
AA seq 425 aa AA seqDB search
MPVGLRASGSSATALSPVLKQATPVVAARGQGCYLYDETDREYLDFTAGIGVVSTGHCHP
RVVEAAQRQVATLIHGQYTTVMHRPLQNLVRRLGEVLPPSLNSLFFANSGSEAIEAAVRL
ARQATGRPNIIVFQGGFHGRTLAAATMTTSGPRFSSGIGPLMAGVYSAPFPTAYRYGWSE
AEATRFALQELDYLFATATAPGQVAAMVIEPVLGEGGYIPANTEFLTGIAERAREHGILL
VLDEVQTGFGRTGQYFGHQHFGVTPDVLVMAKGIASGFPISGIAASAELMGRAWPGSQGG
TYGANAVACAAALATLDVIDEEGLVDNARARGQELLDGARKIAADRGIDGDVRGLGLMVG
VEFSQDGRPAPQRAARAQAAAAENGLLLLMCGPHMNVVRMIPPLVVTADQISDALGIWSS
VVAGL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcggtcttcgcgcaagcggctcatccgcaaccgcgctatcacccgttctcaag
caggccaccccagtggtggcggcgcgaggccagggttgctatctgtacgacgaaacagac
cgcgaatacctggatttcaccgcgggaatcggtgtggtgagcaccggccattgccatccg
cgcgtggtcgaggccgcgcagcggcaggtagccaccctcatccacgggcagtacacgacg
gtgatgcaccgcccgctgcagaatttggtgcggcgcctcggcgaggtactcccgcctagc
ctgaattcactgtttttcgccaactctggcagtgaagccatcgaggctgccgtgcggctg
gcgcgtcaggccaccggacgtcccaatatcattgtgttccagggcggatttcatggccgc
acactggccgccgccacgatgaccacctccggaccgcgattctcgtcgggaatcggtcca
ctgatggcgggtgtatacagcgctcccttccccacggcgtaccggtacggctggagcgag
gccgaggccacacggttcgcgctgcaagagctcgactacctgttcgcgacggccaccgcc
ccgggccaggtcgcggcgatggtcatcgagccggtgctcggcgagggcggctacatccct
gccaataccgaattcctcaccggaattgccgagcgcgcgcgcgagcatggcatcctcttg
gtcctcgacgaggtgcagaccggattcgggcgcaccgggcaatacttcgggcaccagcat
ttcggcgtcacaccggatgttctggtgatggccaagggaatcgcgagcggattccccatc
tcgggcatcgctgcctccgccgagttgatggggcgtgcctggccgggttcgcagggcggt
acctacggggccaacgccgtcgcatgtgccgctgcgctggccactctcgacgtgatcgac
gaggagggcctcgtcgacaatgcgcgtgcgcggggccaggaacttctcgatggggctcga
aagatcgccgctgacagaggaatagacggagacgtacgcggcctcggactgatggtcggc
gtggagttcagccaggatggccgaccggcaccgcaacgtgcggcgcgggcacaagcagca
gccgccgagaacggtctattgctactcatgtgcggcccgcacatgaacgtggtgcgcatg
attccgccgctggtggtgacggccgatcagatatccgatgctctcggtatctggagcagt
gtggtggcggggctgtga

DBGET integrated database retrieval system