KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_0275Help
Entry
MMASJCM_0275      CDS       T03694                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: BAP95051
LinkDB All DBs
Position
complement(276977..278008)
Genome map
AA seq 343 aa AA seqDB search
MLAKPVAKIPDGASYEPKWDGFRSIVFRDGDEVELGSRNEKPLTRYFPELVAAVLAELPP
RCVVDGEIVIATEAGLDFEALQQRIHPADSRVRLLAEQTPSSFIAFDLLALGDEDYTGRP
FSERRAALAEALSGAGASIHLTPATTDQALAQRWFEEFEGAGTDGLIAKPLAIAYQPDKR
VMFKIKPERTADCVVAGYRVHKSGDDAIGSLLLGLYQEDGVLASVGVIGAFPMAERKRLF
QELQPLVIPLENHPWNWAAHEAGERTPQKNAGSRWNAGKDLSFVPLRPERVVEVRYDHME
GVRFRHTAQFNRWRPDRDPRSCTYEQLEQPITFSLNDIVPGLV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccaaacctgtcgcaaaaatccctgacggcgcctcctacgaacccaagtgggat
ggattcaggtcgatcgtctttcgcgacggcgacgaggtggagctgggtagccgcaacgag
aagccactgacccggtacttccccgagttggtagcggcggtgctcgccgaactaccgcca
cggtgtgtcgtcgacggtgagatcgtgatcgccaccgaagcgggtctggatttcgaggcg
ctgcaacaacggatccacccggctgattcgcgggtacggctattggccgagcagacaccc
tcctccttcatcgcattcgacctgctcgccttgggcgacgaggactacaccgggcggccc
ttcagcgagcgccgtgccgcgctggcggaggcattgtccggcgcgggtgcgtcgattcac
ctcacgcccgccaccacagatcaggcactggcgcagcgctggttcgaggaattcgagggt
gccggcaccgacggtctcatcgcgaagccgttggccatcgcctaccaacccgacaaacga
gtgatgttcaagataaagccggagcgaaccgcggattgcgtggtcgcgggctaccgagtg
cacaaatcgggtgacgatgccatcggctcgctgctgctgggcctgtaccaggaggacggc
gtattggcgtcggtcggtgtgatcggcgcgttccctatggccgaacgcaagcgcctattc
caagaactacaaccgttggtcatcccgctcgaaaatcacccatggaactgggccgcacac
gaagccggcgagcgcactccgcagaagaacgccggctcccgctggaacgcgggcaaggat
ctttcgttcgtcccgctgcgtcccgagcgggtggtggaggttcgctacgaccacatggag
ggtgtgcggttccgccataccgcgcagttcaaccgctggcgcccggatcgcgacccgcga
tcctgcacctacgagcagctagaacaaccaattacattcagcctcaacgatattgttcca
ggtctggtgtga

DBGET integrated database retrieval system