KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_2477Help
Entry
MMASJCM_2477      CDS       T03694                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Pathway
mabl00380  Tryptophan metabolism
mabl00630  Glyoxylate and dicarboxylate metabolism
mabl01110  Biosynthesis of secondary metabolites
mabl01130  Biosynthesis of antibiotics
mabl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mabl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MMASJCM_2477
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MMASJCM_2477
Enzymes [BR:mabl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MMASJCM_2477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: BAP97253
LinkDB All DBs
Position
complement(2485812..2487920)
Genome map
AA seq 702 aa AA seqDB search
MDHTSNPKQEQLDTSRVDRASGYLTTQQGVRVDHTDDALTAGVRGPTLLEDFHAREKVTH
FDHERIPERVVHARGAGAYGYFEPYDAWLSDFTAAKFLTTPGLRTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTQQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPDNEIPQAASA
HDTLWDFVAEQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNDAGEGVFVKFHWKP
LLGVHSLLWDECQQIAGKDPDFNRRDLWDAIESGQFPEWELGVQLVPESDEFKFPFDLLD
ATKIIPEEQVPVQPVGRMVLDRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPIAEVHNNQQDGFAQHDIPQGKSSYFKNTLGGGCPALAHE
DVFRHYTQRVDGHKIRQRAESFKDFYSQARMFWKSMSAIEAQHIVSAFSFELGKVSAESG
IRERVVVQLNLVEHDLASQVALQLGLPAPAPQSADEALPPSPALSQLSSTRDSVATRRIA
VLAADGVDIHGVDLLRTALEESDAIVEILAPTGGGTLTGESGGELRVDRAMTTMASVLYD
AVVVPSGAESAWRLARNGFAVHFVSEAYKHLKPVAAYGAGLDLLRAASVVETLATTAEIV
VDDGVVTTTAEASALPAEFVAAFVTAISRHRAWERETEMVPA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtggaccacacgtcgaatcccaaacaagagcaactcgacacgtctcgggtggaccgcgcc
tctggttatctcactacccagcaaggcgttcgcgtcgaccacaccgatgacgcgctcacc
gccggcgtcaggggccccacgttgctggaggatttccacgcgcgcgagaaagtcacgcat
tttgaccacgaacgaattccagagcgtgtggttcatgcgcgcggcgcgggcgcatacggc
tatttcgagccgtacgacgcgtggctatcggacttcacagccgcgaaatttctcaccaca
cccggcctgcgcacaccggtgttcgttcgtttctctaccgttgcgggctcccgcggctcg
gcagacaccgtgcgcgacgtacgtggatttgccacgaaattctatacacagcaaggaaat
tacgatctggtcggtaacaatttcccggtattcttcatccaggacggcatcaaattcccg
gacttcgtgcacgcggtgaagcctgagcccgacaacgagatcccgcaggccgcctcggcg
catgacaccttgtgggacttcgtggccgagcagcccgagacgctacacgcgatcatgtgg
ctcatgtccgatagggctctgccccgcagctaccgcatgatgcaagggttcggcgtacac
accttccgattggtcaacgacgccggcgagggcgtttttgtgaagttccactggaagccg
ctgctaggcgttcactcactgctgtgggacgaatgtcagcagatcgccggcaaggacccc
gatttcaaccggcgcgatctctgggacgcgatcgagtccggccagtttccggaatgggag
ctcggagtgcaactggtaccggaatccgacgagttcaaattccccttcgaccttcttgac
gcaacgaaaatcattccggaagaacaggttccggtgcagcctgtcggacgcatggtgctg
gatcgcaaccccgacaacttctttgccgagacagaacaggtcgcattccacacggccaat
gtggtgccgggaatcgacttcaccaacgacccgctgcttcagtttcgtaacttctcctac
ctggatacacaactgatccgcctaggcggcccgaacttcgcacaactgcccatcaacaga
ccgatcgccgaggtgcacaacaaccagcaagacggcttcgcgcagcatgacatcccacaa
ggcaagtcaagctatttcaagaacaccctcggcggcggctgcccggccctggcgcatgaa
gatgtcttccgccactacacccaacgagtggacgggcacaagatccgccagcgcgccgag
agcttcaaggatttctacagccaggcgcggatgttctggaagagtatgtccgccatcgag
gcgcagcacatcgtttcggcgttctcgttcgaactgggcaaggtgagtgccgagtccggg
attcgcgaacgtgtggtcgttcaactcaacctggtggaacacgatcttgcttcccaagtc
gccttgcagctgggcttacctgccccggcgccgcaatcggccgacgaggctcttccgccg
tccccggcgctgtcccagctctccagcacccgagacagcgtcgccacccgacggatcgcg
gtgctcgcagccgacggtgtcgacatccatggcgtggatctccttcgtacggcgctggaa
gagagcgacgcgattgtcgagatactcgcaccgactggcggcggaacgctcaccggcgaa
tccggcggcgaactccgcgtcgaccgcgcgatgaccaccatggcctcggtgttatacgac
gccgtggtcgtaccgtccggagccgaatccgcctggcggctggcgcgcaacggattcgcc
gtgcatttcgtttccgaggcctacaaacatctcaagcccgtcgcggcctacggtgccggg
ctcgatctgctccgggcagcctctgtggtggaaacactcgccaccaccgcggagattgtg
gttgacgacggcgtggtgacgaccaccgcggaagccagtgcattgccggccgaattcgtg
gccgcgtttgtcacggcgatcagccggcatcgcgcctgggaacgcgagaccgagatggtg
cccgcatag

DBGET integrated database retrieval system