KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_4398Help
Entry
MMASJCM_4398      CDS       T03694                                 

Definition
(GenBank) alanine transaminase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Pathway
mabl00220  Arginine biosynthesis
mabl00250  Alanine, aspartate and glutamate metabolism
mabl00290  Valine, leucine and isoleucine biosynthesis
mabl01100  Metabolic pathways
mabl01110  Biosynthesis of secondary metabolites
mabl01130  Biosynthesis of antibiotics
mabl01210  2-Oxocarboxylic acid metabolism
mabl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mabl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MMASJCM_4398
   00290 Valine, leucine and isoleucine biosynthesis
    MMASJCM_4398
   00220 Arginine biosynthesis
    MMASJCM_4398
Enzymes [BR:mabl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MMASJCM_4398
    2.6.1.66  valine---pyruvate transaminase
     MMASJCM_4398
Amino acid related enzymes [BR:mabl01007]
 Aminotransferase (transaminase)
  Class I
   MMASJCM_4398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAP99174
LinkDB All DBs
Position
4395780..4397024
Genome map
AA seq 414 aa AA seqDB search
MPGLSPRQHQRVFAQSTKLQDVLYEIRGPVHAHAARLEAEGHRILKLNIGNPAPFGFEAP
DVIMRDIIQALPYAQGYSDSKGILPARRAVVTRYELVDGFPYLDVDDVFLGNGVSELITM
TTQALLDNGDQVLIPAPDYPLWTAATSLAGGTAVHYLCDETNGWMPDIEDLESKITERTK
ALVIINPNNPTGAVYSREILTKMVELARKHQLLLLADEIYDKILYDDAEHISVASLAPDL
LCFTFNGLSKAYRVAGYRSAWLAITGPKDHAASLLEGVNLLANMRLCPNVPAQHAIQVAL
GGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPQGALYAFPRLDPEVHHIHDDDQ
LVLDLLLNEKILLTQGTGFNWPEPDHLRIVTLPWARDLAVAIERLGNFLASYRQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggcctttcgccgcggcagcatcagcgggtcttcgcgcagtccaccaagctacaa
gacgtcctgtacgaaatcaggggtccggtacacgcacacgccgcccggctcgaggctgag
ggtcatcgcatcctcaagctcaacatcggcaaccctgcgccgttcggattcgaggcgccc
gatgtcatcatgcgcgacatcatccaggcgctcccctacgcacagggctactccgactcc
aagggcatcctgcccgcccggcgcgcggtggtcacccgctacgaactggtcgacgggttc
ccgtacctggatgtggacgacgtcttcctgggcaatggggtatccgagctgatcaccatg
accacccaggcgctgctcgacaacggcgaccaggtgctcatcccggcgcccgactatccg
ctgtggaccgccgcgacctcacttgccggcggcaccgcggtgcattacctgtgcgacgag
accaacggctggatgcccgatatcgaggatctggaatccaagatcaccgagcgcaccaag
gccctcgtcatcatcaacccgaacaacccgaccggcgcggtatacagccgcgagatcctc
acgaagatggtcgaactggcccgcaagcatcagttactgctgctggccgacgagatctac
gacaagatcctgtacgacgacgccgagcacatcagcgtcgcgtcactggccccggatctg
ttgtgtttcaccttcaatggcctgtccaaggcatatcgagtggccggctaccggtcagca
tggcttgccatcaccgggcccaaggaccacgccgccagcctgctggaaggcgtgaacctg
ctggccaatatgcgactgtgcccgaatgttcctgcccagcatgcgattcaggtggccctc
ggtggacaccagagcatcgaggatctggtgttaccgggtggtcgcctgctggagcagcgc
gatgtcgcctggacaaagctcaacgagatccccggtgtctcctgcgtcaagccgcagggt
gcgctctacgcgttcccgcgcctggaccccgaggtgcaccatatccacgacgacgaccag
ctcgtcctggatctgctgctcaacgagaagatcctgctgacgcagggcaccggcttcaat
tggcctgagcccgaccatcttcggatcgtcacgttgccatgggcccgtgaccttgccgtc
gccatcgagcgcctgggcaacttcctggcgagctaccgccagtag

DBGET integrated database retrieval system