KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_4478Help
Entry
MMASJCM_4478      CDS       T03694                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Pathway
mabl00250  Alanine, aspartate and glutamate metabolism
mabl00410  beta-Alanine metabolism
mabl00640  Propanoate metabolism
mabl00650  Butanoate metabolism
mabl01100  Metabolic pathways
mabl01120  Microbial metabolism in diverse environments
Module
mabl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mabl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MMASJCM_4478
   00650 Butanoate metabolism
    MMASJCM_4478
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MMASJCM_4478
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MMASJCM_4478
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mabl01007]
    MMASJCM_4478
Enzymes [BR:mabl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MMASJCM_4478
Amino acid related enzymes [BR:mabl01007]
 Aminotransferase (transaminase)
  Class III
   MMASJCM_4478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF982
Motif
Other DBs
NCBI-ProteinID: BAP99254
LinkDB All DBs
Position
complement(4476312..4477589)
Genome map
AA seq 425 aa AA seqDB search
MPVGLRASGSSATALSPVLKQATPVVAARGQGCYLYDETDREYLDFTAGIGVVSTGHCHP
RVVEAAQRQVATLIHGQYTTVMHRPLQNLVRRLGEVLPPSLNSLFFANSGSEAIEAAVRL
ARQATGRPNIIVFQGGFHGRTLAAATMTTSGPRFSSGIGPLMAGVYSAPFPTAYRYGWSE
AEATRFALQELDYLFATATAPGQVAAMVIEPVLGEGGYIPANTEFLTGIAERAREHGILL
VLDEVQTGFGRTGQYFGHQHFGVTPDVLVMAKGIASGFPISGIAASAELMGRAWPGSQGG
TYGANAVACAAALATLDVIDEEGLVDNARARGQELLDGARKISADRGIDGDVRGLGLMVG
VEFSQDGRPAPQRAARAQAAAAENGLLLLMCGPHMNVVRMIPPLVVTADQISDALGIWSS
VVAGL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcggtcttcgcgcaagcggctcatccgcaaccgcgctatcacccgttctcaag
caggccaccccagtggtggcggcgcgaggccagggttgctatctgtacgacgaaacagac
cgcgaatatctggatttcaccgcgggaatcggtgtggtgagcaccggccattgccatccg
cgcgtggtcgaggccgcgcagcggcaggtagccaccctcatccacgggcagtacacgacg
gtgatgcaccgcccgctgcagaatttggtgcggcgcctcggcgaggtactcccgcctagc
ctgaattcactgtttttcgccaactctggcagtgaagccatcgaggctgccgtgcggctg
gcgcgtcaggccaccggacgtcccaatatcattgtgttccagggcggatttcatggccgc
acactggccgccgccacgatgaccacctccggaccgcgattctcgtcgggaatcggtcca
ctgatggcgggtgtatacagcgctcccttccccacggcgtaccggtacggctggagcgag
gccgaggccacacggttcgcgctgcaagagctcgactacctgttcgcgacggccaccgcc
ccgggccaggtcgcggcgatggtcatcgagccggtactcggcgagggcggctacatccct
gccaataccgaattcctcaccggaattgccgagcgtgcgcgcgagcatggcatcctcttg
gtcctcgacgaggtgcagaccggattcgggcgcaccgggcaatacttcgggcaccagcat
ttcggcgtcacaccggatgttctggtgatggccaagggaatcgcgagcggattccccatc
tcgggcatcgctgcctccgccgagttgatggggcgtgcctggccgggttcgcagggtggt
acctacggggccaacgccgtcgcatgtgccgctgcgctggccactctcgacgtgatcgac
gaggagggcctcgtcgacaatgcgcgtgcgcggggccaggaacttctcgatggggctcga
aagatctccgctgacagaggaatagacggagacgtacgcggcctcggactgatggtcggc
gtggagttcagccaggatggccgaccggcaccgcaacgtgcggcgcgggcacaagcagca
gccgccgagaacggtctattgctactcatgtgcggcccgcacatgaacgtggtgcgcatg
attccgccgctggtggtgacggccgatcagatatccgatgctctcggtatctggagcagt
gtggtggcggggctgtga

DBGET integrated database retrieval system