KEGG   Methanosarcina acetivorans: MA_0152
Entry
MA_0152           CDS       T00080                                 

Definition
(GenBank) predicted protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mac  Methanosarcina acetivorans
Pathway
mac00300  Lysine biosynthesis
mac01100  Metabolic pathways
mac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MA_0152
Enzymes [BR:mac01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MA_0152
SSDB
Motif
Pfam: NAD_binding_2 Mur_ligase UDPG_MGDP_dh_N MAAL_N
Other DBs
NCBI-ProteinID: AAM03605
UniProt: Q8TUC1
LinkDB
Position
complement(183063..183842)
AA seq 259 aa
MALLTPEDLENINRQLHEADSTVRRVTGLDIKGVCKDFYGTTPCCEKVGIVPVTSGNGII
GNFSESLRAITEYFGFDSFVTTMPDVSGYYEAVRNGAQIILMADDNTFLAHNLKNGKIAN
NQPCTGIIYAEIASRYMKADSKDVLAVGLGKVGFPGAAHLVNKGFRVYGYDADKALLEKT
VSDLGITPFEPENPRRFSIIFEATPCADTVPESVISDNCVISTPGIPCAISRELQEKYGV
ELIMEPLGIGTASMLYSIL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccggaagacctggaaaacattaacagacagcttcatgaagctgat
tctactgtacggagagttacagggcttgacattaaaggagtctgcaaagacttctacggc
acgaccccatgctgtgaaaaggtaggcattgtacctgtgacctcgggaaacgggataata
ggaaatttctcggaatccctgcgtgcaattaccgaatatttcggatttgacagctttgtt
acgactatgcctgatgtaagcgggtactatgaggcagtaagaaacggcgcccagattatc
ctcatggcggatgacaataccttccttgcccataacctcaaaaacgggaaaatagccaat
aaccagccctgcacaggcataatttatgcggaaatagcctccagatacatgaaagccgat
tcaaaagacgtacttgccgttggcctgggaaaggtgggttttccgggagcagcgcacctc
gtaaataagggcttcagggtctatggctatgatgctgataaagcccttcttgagaaaacc
gtttctgaccttggaattactccttttgaacccgaaaacccgagaagattttccattatt
ttcgaggcaactccctgtgcggacacggttcccgaatccgtaatttcggataactgcgta
atttccacccccggaatcccctgcgcaatttccagggagcttcaagaaaagtacggagtg
gaacttataatggaacctctcgggatagggacggcatccatgctgtattctatcctgtaa

DBGET integrated database retrieval system