KEGG   Methanosarcina acetivorans: MA_4653Help
Entry
MA_4653           CDS       T00080                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mac  Methanosarcina acetivorans
Brite
Enzymes [BR:mac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MA_4653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AAM07987
UniProt: Q8TH69
LinkDB All DBs
Position
5744219..5745391
Genome map
AA seq 390 aa AA seqDB search
MHKEENGEIDPDFINRLAGFLGFEEERVRHLFEKKYLARNWGKHEHMLRFDKEISHIEHG
TVLYEKGSSFEIIMGFPKIRRAMVLDPTLKKHFNGLSKLAIEEKMNGYNVRVAQVDGEIL
AITRSGYICPYTTERANVKLNLEFFDAFPELVLYGEMVGPDNPYVPKTIYDIESVEFFIF
DIREKNTGKPLPTAKRRELMEKYGFFQVRSFGEIPLETAPEEIAGIIRELGKNEHEGVVI
KDPEMVLPSLKYTSSQSNCSDLRHAFKFYNEAGRDYMLSRIVREGFQTVEWNEDETEFKE
RCIQLGESILTPLRESIRNVKDGERLYEEVRIRVRDLKTVTEFENYLKRLGVDTIFETPQ
LAGNEYLVNIKKVNKSTNDKTQAIWEGELW
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagaggagaatggggaaatagatcctgactttataaaccggctggcgggtttc
ctgggctttgaagaagagagagtccggcacctttttgaaaagaagtaccttgcccggaac
tggggaaaacatgagcatatgctccgttttgacaaagaaatttcccatatagagcacgga
accgtactttatgaaaaaggcagctcttttgaaattattatgggcttcccgaagatccgg
agagccatggttctggaccccacacttaaaaaacacttcaacggcctcagcaaactggct
atagaagaaaagatgaacggatacaacgtccgggtagcgcaggtagacggagagatcctt
gcgatcacccggagcgggtatatctgcccttacacaacagaaagggcaaatgtaaaactt
aacctggaattctttgacgcttttccggagcttgtgctctacggggaaatggtaggccct
gacaacccatatgtcccgaaaacaatctatgacatcgagtccgtagagtttttcatcttc
gatatccgggagaaaaacacaggcaaacccctgcccacagcaaaaaggcgcgagctgatg
gaaaaatacggctttttccaggtgaggtcctttggggaaattcccctggaaacagccccc
gaagaaatcgcaggaatcatccgggaacttggaaaaaacgagcatgaaggcgtggtcatc
aaagacccggaaatggtccttccctctctgaagtacacctcctcccagagcaactgctcc
gacctcaggcacgctttcaagttttacaacgaagccggaagggattacatgctctcccga
atagtcagggagggttttcagaccgtggaatggaacgaagacgaaaccgagttcaaggag
cgctgcatacagcttggagaaagcatcctgacccccctgagagaatccatcagaaacgta
aaggacggggaaaggctctacgaagaggtaagaatcagagtcagagacctgaaaaccgtg
acagaatttgagaattacctaaaaaggcttggggtggatacaatctttgaaacccctcaa
cttgcaggaaacgagtacctggtaaacatcaagaaagtcaataaaagcaccaatgataaa
actcaggcgatctgggaaggagagctctggtga

DBGET integrated database retrieval system