KEGG   Macrococcus sp. IME1552: BHM04_02325
Entry
BHM04_02325       CDS       T05070                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00020  Citrate cycle (TCA cycle)
macr00190  Oxidative phosphorylation
macr00650  Butanoate metabolism
macr01100  Metabolic pathways
macr01110  Biosynthesis of secondary metabolites
macr01120  Microbial metabolism in diverse environments
macr01200  Carbon metabolism
Module
macr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
macr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:macr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BHM04_02325
   00650 Butanoate metabolism
    BHM04_02325
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BHM04_02325
Enzymes [BR:macr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BHM04_02325
    1.3.5.4  fumarate reductase (quinol)
     BHM04_02325
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8
Other DBs
NCBI-ProteinID: ATD30076
LinkDB
Position
435437..437200
AA seq 587 aa
MAKSNIIVVGGGLAGLMATIKAAEAGTSVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPLIHFDDTVYGGDFLANQPPVKAMTAAAPGIIHLLDRMGVMFNRTPEGLLDFRRFGGTL
YHRTAFAGATTGQQLLYALDEQVRKFEVEGLVTKYEGWEFLGAVIDDEGAARGIVAQNLT
TSEIKSFGSDAVIMATGGPGIIFGKSTNSMINTGSAASVVYQQGAIYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDAHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGIWV
DYDQMTNIPGLFAAGECDYSQHGGNRLGANSLLSAIYGGMVAGPNAIKYIKALDKSYTDL
PDDIYTRKVEEEQQRFDALLNMKGSENAYKLHKELGEIMTANVTVVRHNDRLLETDKKII
ELMERYHDIDMEDTALWSNQAVFFTRQLWNMLVLARVMTIGAYNRNESRGAHYKPEFPER
NDEEWLKTTMAKFKGAKEAPEFYYEPVDVSLIPPRVRDYSKKSKGGK
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggcaaaaagtaatatcattgttgtcggcggtggattagccggattaatggcaacaatt
aaagcagcagaggcaggtacaagtgttgatcttttctcattagtacccgttaaacgttct
cactcagtgtgtgcacaaggcggtattaatggtgcagtaaatacgaaaggcgaaggtgac
tcacctttaattcactttgatgatacagtatatggtggagatttcttagcaaaccaacca
cctgttaaagcgatgacagcagcagcgcctggtatcatccatttattagaccgtatgggt
gttatgttcaacagaacacccgaaggattacttgatttccgtcgtttcggtggaacgtta
tatcaccgtacagcatttgctggtgcgacaacaggacaacaattattatatgcattagac
gagcaggtacgtaaatttgaagtcgaaggtttagttacgaagtatgaaggatgggaattc
ttgggcgcagttattgatgacgaaggcgctgcacgtggtatcgttgctcaaaacttaaca
acttctgaaattaaatcatttggttcagatgcagttattatggcgactggtggtcctggt
attatctttggtaagtctacaaactctatgattaatacaggatctgcagcttctgttgtc
tatcaacaaggtgcaatctatgccaatggtgaattcattcaaattcacccgacagcaatt
cctggtgatgataaattacgtttaatgagtgaatcagcacgtggtgaaggtggtcgtgtt
tggacttataaagacggtaaaccttggtacttcttagaagagaaatatcctgactatggt
aacttagtacctcgtgatatcgcaacgcgtgaaatctttgacgtatgtgtgaaccaaaaa
ttaggtatcaatggtgagaacatggtataccttgatttaagtcataaagatgcacatgaa
ttagacgttaaattaggtggaatcatcgaaatttacgaaaaattcactggtgatgaccct
cgtaaagtgccgatgaagattttccctgcagtgcattattcaatgggtggaatctgggta
gattacgatcagatgacgaacattccaggattatttgcagcaggtgaatgtgattactct
caacacggtggtaaccgtctaggtgcgaactctttattatctgcaatatacggcggtatg
gtagcaggtccaaatgctattaaatatattaaagcgctagataaatcatatacagattta
ccggatgatatttatacacgtaaagttgaagaagagcaacaacgtttcgatgctttatta
aatatgaaaggttctgagaatgcatataaactgcataaagaacttggtgaaattatgacg
gcaaacgtaacagttgtacgtcataacgaccgattattagaaacagataagaaaattata
gaattaatggaacgttaccatgatattgatatggaagacactgcgttatggagtaaccag
gcagtattctttacacgtcaattatggaacatgttagtgttagcacgcgttatgacaatt
ggtgcgtataatcgtaatgaatcacgtggtgcacattacaaacctgaattccctgaacgt
aatgacgaagagtggttaaaaacaacgatggctaagtttaaaggcgctaaagaagcacct
gaattctactatgagccagttgatgttagcttaatcccaccacgtgtacgtgactattct
aagaagtcaaaaggaggtaaataa

DBGET integrated database retrieval system