KEGG   Macrococcus sp. IME1552: BHM04_03145Help
Entry
BHM04_03145       CDS       T05070                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00061  Fatty acid biosynthesis
macr00620  Pyruvate metabolism
macr00640  Propanoate metabolism
macr01100  Metabolic pathways
macr01110  Biosynthesis of secondary metabolites
macr01120  Microbial metabolism in diverse environments
macr01130  Biosynthesis of antibiotics
macr01200  Carbon metabolism
macr01212  Fatty acid metabolism
Module
macr_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:macr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BHM04_03145
   00640 Propanoate metabolism
    BHM04_03145
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BHM04_03145
Enzymes [BR:macr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BHM04_03145
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BHM04_03145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK zf-met
Motif
Other DBs
NCBI-ProteinID: ATD30230
UniProt: A0A290USY3
LinkDB All DBs
Position
588129..589475
Genome map
AA seq 448 aa AA seqDB search
MKKVLVANRGEIAVRIIRALKELNIQSVAVYSEADRDALHTQIADEAYCIGPKQSKDSYL
NIPNILMIASSTGCDGIHPGYGFLAENANFAEMCEACQIKFIGPSHYSISKMGIKDVAKK
EMIKANVPVVPGSDGLLESVEDALTLANQMGYPVILKATAGGGGKGIRVARNDEELRNGY
MMTEQEAATAFGNPGLYLEKFIEEFRHVEIQILADQYGNVIHLGERDCTIQRRMQKLVEE
SPSPILDDTTRTAMGQAAIRAAEAVNYEGAGTVEFIYDLATKAFYFMEMNTRIQVEHPVT
EMVTGIDLVKWQIKIASGERLTTQQDDVMMSGHAIELRINAENPYKNFMPSPGKITQYVV
PGGNGVRIDSACYTNYIIPPFYDSMVAKLIVYQPTRAEAIECAKRALDEFVVTGVDTTIP
FHLALMENDTFKSNDYSTKFLEQNEILS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtattagtcgcaaatcgtggcgagatagcagtaagaatcattcgtgcgtta
aaggagttaaatatacagtcagtagctgtctattctgaggcagaccgtgatgccttacat
actcaaattgcagatgaagcttattgtatcggaccgaaacaatcgaaagattcttattta
aatatcccgaatattttaatgatcgcaagctctacaggttgcgatggtattcatcctggt
tatggttttttagctgagaacgcaaattttgcagaaatgtgcgaagcatgtcaaattaaa
tttatcggaccgagtcactattcaatctctaaaatgggaatcaaggacgtagccaagaaa
gaaatgataaaagcaaatgttcctgttgttcctggaagtgatggattattagaaagtgtt
gaagatgcattgacacttgcgaatcaaatgggttatccggttatcttaaaagcgactgct
ggtggtggtggcaaagggatacgtgtagcaagaaatgatgaagaacttcgcaatggttat
atgatgaccgaacaggaagctgctacagctttcggtaatccagggctatatttagagaaa
tttatcgaggaatttcgtcatgtggaaatccaaatattggctgatcaatacggaaatgta
atacatctcggtgaacgagattgtaccatccagcgtcgtatgcaaaaacttgtagaagaa
tcaccttcgcctatattagatgatacaacgagaacagcaatgggtcaggcagcaatacgt
gcagctgaagctgtaaattacgaaggtgctggtaccgttgaatttatctatgatttagca
acgaaagcattttactttatggaaatgaatacacgcattcaggttgaacatccggtgact
gaaatggtgacaggaattgatctggtgaaatggcagataaaaattgcctcaggagaaaga
ctcacgacacaacaggatgatgttatgatgtcaggtcatgcgattgaactcagaataaat
gcagagaatccatataaaaattttatgccatctccgggtaaaattactcaatatgttgta
ccaggtggaaatggtgtaagaatagattcagcgtgttatacgaactatataattccacct
ttctacgactcgatggtggctaaactaatcgtatatcaaccaacacgtgcagaagcgatt
gaatgtgccaaacgtgcactagatgaatttgttgtaacgggagttgatacgacgatacct
ttccaccttgcattaatggaaaatgatactttcaaatctaatgactatagcacgaagttt
ttagaacaaaatgaaatactttcataa

DBGET integrated database retrieval system