KEGG   Macrococcus sp. IME1552: BHM04_05905
Entry
BHM04_05905       CDS       T05070                                 

Definition
(GenBank) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00010  Glycolysis / Gluconeogenesis
macr00020  Citrate cycle (TCA cycle)
macr00260  Glycine, serine and threonine metabolism
macr00280  Valine, leucine and isoleucine degradation
macr00310  Lysine degradation
macr00380  Tryptophan metabolism
macr00620  Pyruvate metabolism
macr00630  Glyoxylate and dicarboxylate metabolism
macr00640  Propanoate metabolism
macr01100  Metabolic pathways
macr01110  Biosynthesis of secondary metabolites
macr01120  Microbial metabolism in diverse environments
macr01200  Carbon metabolism
Module
macr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
macr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
macr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:macr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BHM04_05905
   00020 Citrate cycle (TCA cycle)
    BHM04_05905
   00620 Pyruvate metabolism
    BHM04_05905
   00630 Glyoxylate and dicarboxylate metabolism
    BHM04_05905
   00640 Propanoate metabolism
    BHM04_05905
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BHM04_05905
   00280 Valine, leucine and isoleucine degradation
    BHM04_05905
   00310 Lysine degradation
    BHM04_05905
   00380 Tryptophan metabolism
    BHM04_05905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:macr04147]
    BHM04_05905
Enzymes [BR:macr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BHM04_05905
Exosome [BR:macr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BHM04_05905
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like FAD_binding_3 NAD_binding_8 3HCDH_N UDPG_MGDP_dh_N DAO Thi4 AlaDh_PNT_C Ub-Mut7C
Other DBs
NCBI-ProteinID: ATD30745
LinkDB
Position
complement(1130877..1132283)
AA seq 468 aa
MVVGDFPIETDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGSLGGVCLNVGCIPSKALLS
ASHKYENAVHSEDFGIKAENVTVDFSKVQEFKGGVVKKLTGGVGALLKGNKVEIVEGEAY
FVDQNNLKVMTEKASQTYTFKNAIIATGSRPIEIPNFKFNKRVIDSTGALALTEIPKSLV
VVGGGYIGSELGTAYANFGTKVTILEGAKDILGGFEKQMTQVVKKGLKAKGVDIVTEAMA
KSAEESETGVKVTYEAKGETQTIEADYCLVTVGRRPNTEEIGLESLGVKMTERGLVEVNE
EGRTSVDNIFAIGDIVAGPPLAHKASYEGKVAAEVISGEKSEVDYLAIPAVCFTEPELAT
VGYTEAMAKEEGLEYKASKFPYAANGRALSIGETDGFLKLITLKEDGLLIGAQIAGSGAS
DMIAELGLAIETGMTAEDIALTIHAHPSLGEITMEAAEVALGNPIHTM
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggtagttggagattttcctattgaaacagatactattgtaatcggagcaggtcctgga
ggatatgttgcagcaattcgtgcagctcaattaggacaaaaagtaacaatcgttgaaaaa
ggtagtttaggtggcgtttgtttaaacgtcggttgtattccttcaaaagctttattatca
gcatctcataaatatgaaaatgctgttcattctgaagatttcggaattaaagctgaaaac
gttactgttgatttttctaaagtgcaagaattcaaaggcggcgttgttaagaaattaact
ggcggtgttggtgcattattaaaaggtaacaaagttgaaatcgttgaaggtgaagcttat
ttcgttgatcaaaacaacttaaaagttatgactgaaaaagcatctcaaacttatactttc
aaaaatgcaattatcgctacaggttcacgtccaattgaaattcctaatttcaaattcaac
aaacgtgtaatcgattcaacaggtgcattagcattaactgaaattccaaaaagcttagta
gtagttggtggtggatatatcggttctgaattaggaactgcttacgctaacttcggtact
aaagttacaattctagaaggcgcgaaagatattttaggcggattcgaaaaacaaatgaca
caagtagttaaaaaaggtcttaaagctaaaggtgtagacattgttactgaagcgatggct
aaatcagctgaagagagcgaaactggtgttaaagtaacttatgaagctaaaggtgaaact
caaacaattgaagcagattactgtttagtaactgttggtcgtcgtcctaatactgaagaa
atcggtttagagtcattaggtgttaagatgactgaacgtggtttagtagaagtaaatgaa
gaaggacgtacttcagtagacaatatctttgcaatcggtgatatcgttgctggacctcca
ttagcacataaagcatcatacgaaggaaaagttgcagctgaagttatctctggtgaaaaa
tcagaagttgactatcttgcaatcccagcagtatgtttcactgagcctgaattagctaca
gttggttacactgaagcgatggcgaaagaagaaggattagaatataaagcttctaaattc
ccttatgcagcaaatggtcgtgctttatctatcggcgaaactgacggattcttaaaatta
atcacattaaaagaagacggattattaatcggtgctcaaatcgctggttctggtgcatct
gatatgatcgctgaactaggattagcaattgaaactggtatgacagctgaagatatcgca
ttaacaattcatgcgcatccatcattaggtgaaattacaatggaagcagcagaagtagct
ttaggtaatccaattcatactatgtaa

DBGET integrated database retrieval system